KEGG   Python bivittatus (Burmese python): 103055763Help
Entry
103055763         CDS       T03091                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103055763 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbi03036]
    103055763 (SETD2)
Enzymes [BR:pbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103055763 (SETD2)
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103055763 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 103055763
NCBI-ProteinID: XP_007434210
LinkDB All DBs
Position
Unknown
AA seq 2396 aa AA seqDB search
MLKDPSGHHKANTSSIADMQSPLRWKGTDNWCIFPKNMDGSEEVEREEENEGKTENVQKT
GFVKGPVFKGVASSRFLPKGTRTKVNLEEQGRQKVSFSFSLTKKTLPNRFLTALGNEKQS
ESVSASAAPLQSDFASKVKTELGDTLGVAEEFSPPKPKAELGKIHFKKHLLNVTTKPSPT
SAGLPVPVTPTPPAAAELGEAPSSPPPPPPPFPPPPPPPPQIKPAPTPVLIPATSPQVSV
AVPAPVAPLLTSPVETIVRTTKEPPSKAPQETLELNVLQNAVLGGSEEHLAQVVSEEAEP
VSVKRHSHIGKEEEIPDNSKGASLSSKKQSSRRKFSLSDGTLPGSESDEDSVRTSSSQRS
HEIKTSANSEKEKDSRKSSASFKMEEQAKFSSRSRSERDEKYSSYSRSERDSRYSSSRSR
SERERRRSRSHSRSRSERGSRTSSSYSRSERSHYYDSDRRYHRSSPYREKTRYSRSYMDS
RARESSDSEEEYRRMYSRSTDSRHTSSHSSSYRDSRTSSSYSKSERESKTESTHTDLERR
GKLAKSDRETRRTSESDVSKRCSPINELRHRRDASHSKAESSVSSSRTKSTSSKTSAPKS
DKFKSSFCCTESEEIKDQSNCVDSETSCVQSCETKTAVTQKPETERTVSPLSQLNDSLTF
RKLDESKTGSPISKMNELAGIDSHISIKEMESLVKVKHDQLRTCSPVELNINGSPEGRNN
NTALSCTSEVEEIEVSSDDSLDRPEPPHQAKSPNLNKLPSNGIQMVCLPKGYNPADSLVF
LGESNLLPKEKMEVSNPSEYECVSSCTKHVNHSKTLSKEVNDLTDSSCKTKDPIPCYFSD
DAPVSLYYSEIEIEAEPSDTKATQESFMGIQTEIHTETFMSAHMEDQNPSRLAQESEKCT
SFSSVEHTPARDFTTEEYFVEVKVDNQCVAQQQQTSENMFQLESPIQQKPNEVLTCPEVA
LELDILHADSIVEKTKSPFKNEHSYYLEMPVKEPEKEEQVEEKDSVPVDERVTSDLEKSP
GVLLMRDKEDSLVESAFSDVLSPSCDIVVTVEETETIEEAPRYGSSSNTPEIFSVHNENY
SDTAESASEQASDESETEDSDSDDSSVPRNRLQSVVVIPKNSTITMEESSSCSSRNSQSN
RRYLDHWEDTRPESSKPFYEDMPDSLELNNSMQNESRGLPSRDTEGSSATSTELKRIETV
GPQPDASQPQSDDVDSTSHSEQASDSFHKPDERIVLNETTSVTRSVGMSQGEELHYLSRN
FEMSNTTARSQTGVSKSDRRQGRSAFAGLSNTADFSREDGFHSTEDLGNLGWDFSQPEKP
SSTYQQPDSSYGVFPGYVYPPPAGPYVGSHNYWHDNGYWDPRLTSRPSAISYERIQGQVP
DSLTEDHEEYEEVDRWVDESQLYFPDQSVKFQARDPREKGSVQGHEISSNSTKDFPVVRE
RKEPVNKVLEKNDMKERGPLKKRRTDLGSDSESDGGSQERKKVKAESEQLPVLPQGSPAA
RPLCFMEDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMLCECPTLS
KEERAQGEVACGEDCLNRLLMIECSSRCPNGEHCSNRRFQRKQHADVEVILTEKKGWGLR
AAKDLPSNTFVLEYCGEVLDHKEFKTRVKEYARNKNIHYYFMALKNDEIIDATQKGNCSR
FMNHSCEPNCETQKWTVNGQLRVGFFTTKLVSSGSELTFDYQFQRYGKEAQKCFCGSTNC
RGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSLSRLMVRI
ETPEQKLTCLKLIQMSSKRKSPSSAEGRSKKQRKAIDLNLKMKIIKAYDAGKKVNIIARE
EGLAHSTISCILKDKERIREAMKGSPGTRAVITRQRKGLIHETEKLLMLWIEDQIQKRMP
VGLLLIQAKARSIFQTLKERAGEECTETFTASRGWFMRFQRRFNYHSAHASGEAAGVEEV
AQRFLNELDDIIAEGNYLPGQIFNVDETGLFWKAMPERTYIHREAQAMPGYKALQDRVTL
LLGGNVAGFKLKPFLIHKSENPCAFKNIGEHTLPIYYRSNRKAWMTQVLFEDWFMNCFIP
QVKEYCLQNRIPFKILLLLDNAPGHPPHLDDLHPDVKVVYLPQNTTPFLQPMDQGAVATF
KAYYLHATFAKAVAAVEDKRVTVREFWKDYNILHCIKNIAAAWQDVTLKCMQGIWKKCLK
RFAVLVNNFEGFDQNEDLDEINKKILTLTKSLDLEVDAEHVKNLIAYTEGELSNEDLIEL
KEELKAQRAEEEEEKEETLEVEPKMFSVKRLAGVFSEVNKILSELESMDPNVERFRKVHR
EIHKILKCYHEIYEEKKKNTAQSKLSGLFKTVSPSSILFPSPSARPRRSSAINQLC
NT seq 7191 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggatcccagtggacatcataaagctaatacctccagcatcgctgacatgcag
tcacctctgaggtggaaagggacagacaactggtgtatctttccaaagaatatggatggg
tctgaagaggtagaaagagaagaagaaaatgagggcaagaccgaaaatgtacagaaaact
ggctttgtcaaagggccagtcttcaagggagtggcctcaagccgtttcttacccaaaggc
acccgaacgaaagtgaaccttgaggagcaagggaggcagaaagtgtccttcagcttcagt
ctcaccaagaagactttgccgaaccgatttctgacagcccttgggaacgagaaacaaagt
gaaagcgtgagcgcttctgccgcaccccttcaaagtgactttgcttccaaggtgaaaaca
gagcttggtgatactttgggggttgcagaggaattttcacccccaaagcctaaggcggaa
ctgggcaagatccattttaagaaacatttgctaaacgttaccacaaaaccttccccgact
tctgccgggctgccagtgccagtaactccaacgccacctgctgcagcagaactgggggag
gcgccgtcatcaccacctccccctccgcccccttttccaccaccccctcctccacctcca
cagataaaaccagctccaacaccagtactaattccagcaacttcaccgcaagtttccgtt
gcagtcccagcacctgttgcacctctgttgacgtcacctgtagaaaccattgttcgaaca
acaaaagaaccaccatccaaagcgccacaggagactttggaactaaacgttctacaaaat
gctgtgctgggtggctctgaagaacatctggctcaagttgtttctgaggaagcagaacca
gtatcagtaaaaagacattcccacattgggaaggaggaagaaattccagataactcaaag
ggtgcttccctgagttctaagaaacagagttcaaggaggaagttctctttgtctgatggt
acgttgccaggttctgaatctgatgaagattctgtgaggacttcttcaagccagaggtcc
catgaaattaaaacatcagcaaactctgagaaagaaaaggattcacgaaaaagctctgct
tctttcaaaatggaagagcaggcaaagttctcttcgcggtctagatcagaaagggatgaa
aaatattccagctattccagatctgagagagattcaaggtactcttcctcacggtcccga
tcggagagagagaggaggcgaagcagatcccattcccgctctagatctgaaagaggttct
agaaccagctcctcttattctagatctgaacggtcacattactatgattctgaccggaga
taccacagaagctcaccatatagagagaagacacgatattcccgttcttacatggacagt
agagcaagggagagttctgattcagaagaagagtatcggaggatgtattctaggtctaca
gattcaaggcatacatcatctcattcctcgtcttacagagattccaggacctcttcctct
tattcaaagtctgagagggaaagcaagacagaatccactcatactgatttggagagaaga
ggaaaacttgcaaagtcagacagagaaacaagaaggacttcagaaagtgatgtatcgaaa
aggtgctctcccatcaatgaactgcgacatcggagggatgcctcccattctaaagcagag
agcagtgtgagttcttcccgaacgaagtccacctcttcaaagacatctgcgcccaagtca
gataaatttaaaagttctttctgttgtacagaatctgaggaaatcaaagatcagtctaat
tgtgtagactcagagacatcttgtgtacaaagctgtgaaacaaaaactgctgttacacag
aagccagaaacagaaaggactgtttctccattaagtcagttaaatgattcacttactttc
agaaagctagatgaatcaaaaacgggttcccctatttctaagatgaatgaacttgcagga
attgatagccatatcagtattaaggaaatggaatctttagttaaagtaaaacatgatcag
ttaaggacatgttctccagtagaactgaatataaatgggtccccagaaggtaggaacaat
aataccgcattgtcctgtacttctgaagtagaagagattgaagtgtcttctgacgatagt
ttagatagacctgagccaccacatcaagccaaaagtcctaatttgaataagttgccatcg
aatggtattcaaatggtatgtctacctaaaggatataatccagccgattctcttgtcttt
ttgggtgaatccaaccttttgccgaaagaaaaaatggaagtttcaaatccttctgaatat
gaatgtgtatcttcttgtaccaagcatgtaaatcactctaaaacattgtctaaagaagtg
aatgacctaacagattcctcttgtaaaaccaaagatcctatcccttgctacttttcagac
gatgcccctgtttctttgtattattcagaaattgaaattgaagcggagccttcagataca
aaagctactcaagaatcttttatgggtattcaaacagagatacatactgaaacatttatg
tcagctcacatggaggatcaaaatccatccagattggctcaggaaagtgaaaaatgcaca
agtttcagttcagtagagcatacaccagccagagattttacaacagaagaatattttgtg
gaagtaaaagtagacaatcagtgcgttgcacagcagcaacaaacttctgaaaatatgttc
cagctggaatcacccatacagcagaagcctaatgaagtcttaacatgtcctgaagttgca
cttgaattagatattctgcatgcagattccattgtagaaaaaacaaaatcaccttttaaa
aatgagcattcttattatttagagatgccagtgaaagaacctgagaaggaagaacaagtt
gaggagaaagattcagttcccgttgatgaaagggtcacgtctgacttggaaaaatctcct
ggagttttgctgatgagagacaaagaggactccctggtggaatctgcattttcagatgtt
ttgtccccttcttgtgatattgtagttactgtagaagaaacagaaactatagaagaagcg
cccaggtatggtagcagcagcaatactccagaaatcttttccgttcacaatgaaaattat
tctgatactgctgaaagtgcgagcgaacaggcgagcgatgaaagtgagacagaggactct
gattcagatgatagcagcgttccaaggaatcgccttcaatccgttgtagtcattccaaag
aattctacaataaccatggaagagagtagttcttgttcctcacggaacagccaaagtaac
agacgttacttggatcactgggaagacaccaggccagagtccagcaagccgttctatgaa
gacatgccagatagcttggaactgaataacagcatgcaaaacgaaagcagaggcttgcct
tctagagacaccgagggaagctcagcaacgtctacggagctcaagagaattgagacagtg
ggtcctcagcccgatgcctcccagcctcagagcgatgatgttgacagtacaagtcactca
gagcaagcatctgattcttttcataagccagacgaaagaatagtcctaaacgaaaccacc
tcggtcactcggtcagttggcatgtcacaaggagaagagctgcactatctttccaggaac
tttgaaatgtccaacacaacggccaggtcacagaccggtgtttccaaatcagaccgtagg
caggggaggtctgcttttgcaggtctctccaacaccgctgatttctccagggaggatggc
tttcattcaacagaggacttggggaacttggggtgggatttctcccaaccagagaagcca
agcagcacataccaacagcctgatagcagctacggagttttcccaggttatgtttatccc
ccacccgcagggccgtatgttgggtctcacaactactggcacgacaatggctactgggac
ccaagactgaccagcagaccttctgcaattagttatgagcgaatccaagggcaggtcccg
gattcactcactgaagatcacgaggagtacgaagaagtggaccgatgggtcgacgaaagc
cagctctatttccctgatcagtcagttaagttccaggcacgtgaccccagagaaaagggt
tctgttcagggccatgagataagcagcaactcgactaaagacttcccagtggtaagagag
agaaaagaaccagttaataaggtgttggagaaaaatgacatgaaagaacgggggccgctg
aaaaaaagaagaaccgatttggggagtgattcggagagtgatgggggctcccaggaaagg
aagaaggtcaaagcagagagtgagcagttgcctgtcctgccccagggctccccggcagct
cggccgttgtgtttcatggaagacttccgggacccacagcgttggaaagagtgtgccaag
caagggaaaatgccctgttactttgatctcattgaagaaaatgtgtatttgacagaaaga
aaaaagaataaatcgcaccgtgacatcaagcggatgctgtgtgaatgtcccactctttcc
aaagaagaacgagcacaaggggaagtagcgtgtggagaagactgtctaaaccgtctgctc
atgatcgaatgttcttcgaggtgtccaaatggagagcattgttccaaccggcggtttcaa
aggaagcagcacgcagatgtggaagtcattctgaccgagaagaaaggctggggcttgaga
gcggcaaaagacctcccttctaacacctttgtcctggaatactgtggtgaagtgctggat
cacaaagaattcaaaaccagagtgaaagaatatgcccgaaacaagaacatccattattac
ttcatggccttgaaaaatgatgagataatagatgcaacacaaaaagggaattgctctcgt
ttcatgaaccacagctgtgaaccaaattgtgagacgcagaagtggacagtgaacgggcag
ctgagggttggctttttcaccaccaagctagtatcatctggctcggagctaacttttgac
taccaattccagagatacggcaaagaagcacaaaaatgtttctgtggctccaccaactgt
cggggttacctcgggggagagaaccgggtcagcattagagccgcaggaggcaaaatgaaa
aaggagcggtcgcgtaaaaaagattcggtggatggagaattagaagcactcctggagaac
ggcgaagggctttccgataagaatcaggtcctcagtttgtcccgcctgatggtgcgaatt
gagaccccggaacaaaagctcacctgtctcaaactcatacagatgtcttcaaagagaaag
agccccagctcagctgaaggaagaagcaagaagcaaaggaaagccatcgatctcaatttg
aagatgaagatcatcaaagcgtatgacgccgggaagaaggtgaatattatagcgcgagaa
gaaggcctggcccattccaccatctcctgtattttgaaggataaggaaaggatcagagag
gcaatgaaaggatcgccagggaccagagcagtgataacaagacagcgaaaaggcctcatc
cacgaaacggaaaaactccttatgctttggatcgaagatcagatacagaagaggatgccg
gttggcctcctcctcattcaggctaaggcacgcagcattttccaaacgctgaaggagcga
gcaggtgaggagtgcaccgaaacgttcacggccagccgtggctggtttatgcggtttcag
cgaagattcaactatcacagcgcgcacgcatcaggtgaagctgcaggtgtcgaagaagtt
gcccaacgttttctgaatgaacttgatgatatcatagcagaagggaactatttgcctggg
cagatattcaatgtggacgaaaccgggctattctggaaagcaatgccagagcggacatac
atacacagagaggcccaagcaatgcctggatataaagcccttcaggacagagtaaccttg
ctgttgggcggaaatgtcgccggattcaagctgaagccctttctgatccacaaatcagag
aatccctgcgcgttcaaaaacataggcgaacacacgttacccatttattaccgatccaat
cggaaggcttggatgacacaagttctctttgaggattggtttatgaattgtttcataccc
caagtaaaggaatattgcttgcagaacagaattccttttaaaattctcctgctcctcgac
aacgcacctggacatcccccgcatctcgacgacctccacccagatgtaaaggtagtttat
ctaccccaaaacaccacccctttcctacagcctatggaccagggagctgttgcaacattc
aaggcgtactatttacatgcaacgtttgccaaagctgtagctgcagtggaggataagagg
gtgacggtgcgtgagttttggaaagactacaatatcctccattgcatcaaaaatatcgca
gcagcatggcaggatgtcactctgaaatgcatgcaagggatttggaaaaaatgtttaaaa
cgttttgctgttcttgtaaataattttgaaggttttgaccaaaacgaagatttggatgaa
ataaataagaaaattttgacactcacaaaatcccttgacttggaggttgatgctgaacat
gtgaaaaatttgatagcctacactgagggagagctttcaaatgaagatttaattgaactg
aaggaagaattgaaagcacaaagggcagaagaggaggaagaaaaagaagaaactttagaa
gttgagcccaaaatgttcagtgttaaaagattggctggtgttttctcagaagttaacaaa
attttatcagaattagaaagtatggatccaaatgtagaacgttttagaaaggttcatcgg
gaaatccacaaaattctaaagtgttatcatgaaatatatgaagaaaaaaagaaaaatact
gcacaaagcaaacttagtgggctctttaagacagttagtccttcctccattctatttccc
tccccatccgcaagacccaggcgatcttcagccatcaaccagctatgctag

DBGET integrated database retrieval system