KEGG   Python bivittatus (Burmese python): 103056904Help
Entry
103056904         CDS       T03091                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial isoform X2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04068  FoxO signaling pathway
pbi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103056904 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103056904 (SOD2)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103056904 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103056904
NCBI-ProteinID: XP_007439691
LinkDB All DBs
Position
Unknown
AA seq 226 aa AA seqDB search
MLCRLGVAASRRNGTALITSLGCLASRKKHTLPDLPYDYGALQPHINAEIMQLHHSKHHA
TYVNNLNIAEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIFWTNLSPNGGGEPKGE
LLEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGFNKESDRLQIAACPNQDPLQGTTGL
IPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVISWENVSSRYAACKK
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgctctgccgtttgggtgtcgcggccagccgcagaaatggcactgcactgattacatct
cttggatgtctggcctccagaaaaaagcacactctccctgacttgccttatgattatggt
gctttgcagccacacattaatgcagaaattatgcagcttcaccacagcaaacatcatgct
acgtatgtaaataatttgaacattgctgaagaaaaatacaaagaggccttggcaaaaggg
gatgtaactgcccaagtgtcccttcagccggctttgaagttcaatggtggaggtcacatt
aatcatactatcttttggacaaacctttctcctaatggtggaggagagccaaaaggggag
ctattggaagccattaaacgcgatttcggctcatttgcaaatttcaaggagaaactcaca
gctgtttcagttggtgtccaaggctcaggctggggatggctcggttttaataaagaatct
gatagactccagattgctgcctgtcctaatcaggatcctctccagggaaccacaggactt
atccctctgttaggaattgacgtatgggaacatgcatattaccttcaatataaaaatgtt
agacctgactatctcaaagctatctggaatgtgatcagctgggaaaatgtatcttcaaga
tatgcagcttgcaaaaaatag

DBGET integrated database retrieval system