KEGG   Python bivittatus (Burmese python): 103057157Help
Entry
103057157         CDS       T03091                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00010  Glycolysis / Gluconeogenesis
pbi00030  Pentose phosphate pathway
pbi00051  Fructose and mannose metabolism
pbi00052  Galactose metabolism
pbi01100  Metabolic pathways
pbi01200  Carbon metabolism
pbi01230  Biosynthesis of amino acids
pbi03018  RNA degradation
Module
pbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103057157 (PFKP)
   00030 Pentose phosphate pathway
    103057157 (PFKP)
   00051 Fructose and mannose metabolism
    103057157 (PFKP)
   00052 Galactose metabolism
    103057157 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103057157 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbi01009]
    103057157 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pbi03019]
    103057157 (PFKP)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103057157 (PFKP)
Protein phosphatases and associated proteins [BR:pbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103057157 (PFKP)
Messenger RNA biogenesis [BR:pbi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103057157 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK CBS
Motif
Other DBs
NCBI-GeneID: 103057157
NCBI-ProteinID: XP_007422069
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MSSKKLFENLSGRGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVEAKVYFIYEGYQGMVDG
GENIVEVTWESVSSILQMGGTVIGSARCKAFRTREGRLKAACNLVKCGITNLCVIGGDGS
LTGANLFREEWNGLLEELARNGEIEEEAVKNYAYLNIVGMVGSIDNDFCGTDMTIGTDSA
LHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADYVFIPEYPPEEGWED
HMCARLSENRARKKRLNIIIVSEGAIDSCNRPITSEQVKDLVVKRLGFDTRVTILGHVQR
GGTPSAFDRILASRMGVEAVLALLEATPETPACVVSLSGNQAVRLPLMECVQMTQDVQKA
MDERRFKEAVELRGRSFSNNLNTYKLLSDKKSEAELPKSNFTVAVLNVGAPAAGMNAAVR
SAVRLGISEGHKMLAVTDGFEGFSKGQIKEIKWGDVGGWTGQGGSILGTKRTLPGKYLEK
IAEQMRAHNINALLVIGGFEAYLGLLELSAVREKYDAFCIPMVMVPATVSNNVPGSDFSI
GADTALNTITDTCDRIKLSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEKF
DIRELQANVEHLTQKMKTSIQRGLVLRNENSSENYTTDFIYQLYSEEGKGVFDCRKNVLG
HMQQGGAPSPFDRNFGTKIAAKAMLWISKKLKESYRREEGRVFANTADSACLLGMRLRNL
VFQPVIELQDETDFVHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVLRPKASEA
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcaagaagctgttcgagaacctctcgggcagaggcaaagccatcggagtcctg
accagcggcggcgatgctcagggtatgaacgcagcagtccgtgcagtggtgcgcatgggg
atctatgttgaagcaaaagtatattttatctatgagggataccaaggtatggttgatgga
ggtgaaaatattgttgaagttacatgggagagtgtttcaagtatcctccaaatggggggg
actgttattggcagtgctcgctgcaaagcttttcggactcgagaaggccgcttgaaagcg
gcctgcaatctggtgaagtgtggaatcacaaacctttgtgtgattgggggagatggcagc
ttgactggggctaatctctttcgggaagagtggaatggcctgttagaggagttggcgaga
aatggtgagattgaagaagaagctgtaaagaactatgcttacctcaacattgtgggaatg
gttggctccattgacaatgatttctgtgggaccgatatgaccattggcacagattcagcc
ctgcacagaatcattgaagttgtggatgccatcatgaccactgctcaaagccatcagagg
accttcgtcctagaggtgatgggaaggcactgtgggtatctagcgcttgttagtgcttta
gcctgtggtgcagactatgtttttatccctgaatatccacctgaggaaggatgggaagat
cacatgtgtgctaggctttctgagaaccgtgcccgaaagaaaaggttgaatattataatt
gtgtcagaaggagcaatcgattcctgcaaccggcctatcacttctgaacaagttaaggat
cttgtggtgaaacgattagggtttgacacacgggtaaccattcttggccatgtgcaacga
ggaggcacaccctctgcttttgatcggattttggccagccgtatgggtgtggaggctgtc
cttgcccttctggaagccacccctgaaactcctgcctgcgtggtgtccctgtctggaaac
caagctgtccgcctgccgttaatggagtgtgttcagatgactcaagatgtacagaaagct
atggatgaaagaagattcaaagaagcagtagaactccgtggaaggagtttttcaaacaac
ttgaatacctacaagctcttgtctgacaaaaagtcagaggctgaactgcccaagagcaat
ttcactgtcgctgtcctaaatgttggtgcaccagcagctgggatgaatgctgctgttcgt
tccgccgtgagacttgggatcagtgaaggacacaagatgttagctgtcactgatggcttt
gaaggcttttctaaagggcagattaaagaaatcaagtggggagatgttggcggttggact
ggccaaggagggtcaatacttggcacaaaacgtacactccctggaaagtatttggagaag
attgcagaacagatgcgagctcataacatcaatgccctccttgttattggtggctttgag
gcatacctgggactattggagctctctgcagtccgggagaaatatgacgcgttctgtatt
cccatggttatggttcctgcaaccgtatccaacaatgtacctggttctgatttcagcatt
ggtgcagacactgctctgaacactatcactgatacctgtgaccgaatcaagctatcagca
agcgggacaaagcgacgtgtgtttatcattgagaccatgggaggctactgcggctacctg
gctaatatgggggctttggctgcaggtgccgatgctgcgtatattttcgaggagaagttc
gacattcgggagctacaggccaatgtggagcatctaactcaaaagatgaaaaccagcatt
cagcgaggtttggtgctgaggaacgaaaatagtagcgagaactacacaactgacttcatt
tatcagctctattcggaagaaggcaaaggggttttcgactgccgaaagaacgtgctgggt
catatgcagcagggtggtgccccttctccatttgatagaaactttgggacaaaaattgca
gcaaaagctatgctgtggatctctaagaaactgaaagaaagctacagaagagaagaagga
agggtgtttgccaatactgcggactctgcgtgccttctaggaatgcgtctgagaaacctc
gttttccagcctgtgattgagctacaggatgaaacagactttgtgcaccgaattcctaag
gaacagtggtggctaaaactgcgtcccctgatgaagatcctggccaaatataaggccagc
tatgatgtttccgactcaggtcagctagagcacgtgcttagaccaaaggcatcagaagcc
tga

DBGET integrated database retrieval system