KEGG   Python bivittatus (Burmese python): 103057363
Entry
103057363         CDS       T03091                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103057363
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pbi03000]
    103057363
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pbi03310]
    103057363
Transcription factors [BR:pbi03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103057363
Nuclear receptors [BR:pbi03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103057363
SSDB
Motif
Pfam: GCR zf-C4
Other DBs
NCBI-GeneID: 103057363
NCBI-ProteinID: XP_007436417
LinkDB
Position
Unknown
AA seq 439 aa
MEPKESLKSTGGEERGKSAHFHPSFRGGASVKTPVSTSTLSASSQSDSKQSVLCDLPKGL
GSNVPQPDLSKAVSLSMGLYMGETDSKVMGNELGFPQQGQISLSPGETDFRLLEESIASL
NKSSSLTESSKGAASTNVHLESEFPAMASRDLTLNQGSLAQGQVNTNSGNLKLFSEDQST
FDILQDFDLPPVSPGKETNGSPWRMDPVLDESSLLSPLGGDESFLLEGSEMEDCKPPILP
DTKPNINECEDLLSNPTMQMPQVKTEKEDFIELCTPGVIKQEKIGTTYCQANFSGSNKVG
NKTSAISVHGVSTSGGQIYHYDLNTASVTQQQDKKPVFNAIPSHPAGSENWNRCQGSGDD
ALTPVGALNFSNRSVFSNGYSSPGIRSDVSSSPSTSSATTGPPPKLCLVCSDEASGCHYG
VLTCGSCKVFFKRAVEGRK
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggagcccaaagaatcgttgaaatccacaggaggggaggaaagagggaaaagtgctcac
tttcatccatcctttaggggtggtgcttctgtcaagactcctgtatctacatctaccctg
tctgcctcttcccagtctgactcgaaacagtctgttctgtgtgacttgccaaaggggtta
ggaagcaatgtgccacagccagatctctccaaagcagtgtcactctcaatgggactgtat
atgggtgaaaccgattcaaaagtgatgggaaatgaacttggatttcctcagcaaggccaa
atcagcctctctcctggagaaacggattttaggctccttgaagaaagcatagcaagctta
aataagtcctctagcctgacagaaagctcaaagggagctgcatctactaatgtgcaccta
gaatcagagttcccagctatggctagtcgtgatcttactttaaatcaagggtctttagca
caaggccaggttaacaccaacagtggcaacttgaagctgttttcggaagaccaaagcacc
tttgatattttgcaagattttgatttgccaccagtgtctccaggaaaagaaacaaatgga
agcccttggagaatggatcctgttctggatgaaagtagcttgctttcacctcttggtggg
gatgagagttttctcttggaaggaagtgaaatggaggattgcaagcctccaattttacca
gacacaaagcctaacattaacgaatgtgaggatcttttgtcaaatcctacaatgcagatg
ccacaagtgaaaactgaaaaggaagattttattgaattgtgcacccctggagtaataaag
caggagaaaataggcacaacttactgtcaggctaatttttctgggtcaaataaagttgga
aataaaacatctgccatttctgttcatggtgtcagtacttctggagggcaaatttaccac
tatgatttgaacactgcatctgtcactcaacagcaggataagaaaccagttttcaatgcc
attccctctcatcctgctggttcagaaaattggaataggtgccagggatctggagatgat
gcccttacaccagtgggggctttgaatttttcaaacagatctgtcttctccaatgggtat
tcaagccctggaataagatctgatgtgagcagttcaccatctacctcttcagcaactacg
ggaccacctcccaagctttgccttgtttgctcagatgaggcctctggttgtcattatggt
gtcctgacatgtggcagctgcaaagtattcttcaaaagagctgtggaaggtaggaaataa

DBGET integrated database retrieval system