KEGG   Python bivittatus (Burmese python): 103057461Help
Entry
103057461         CDS       T03091                                 

Gene name
ELOVL1
Definition
(RefSeq) elongation of very long chain fatty acids protein 1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00062  Fatty acid elongation
pbi01040  Biosynthesis of unsaturated fatty acids
pbi01100  Metabolic pathways
pbi01212  Fatty acid metabolism
Module
pbi_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    103057461 (ELOVL1)
   01040 Biosynthesis of unsaturated fatty acids
    103057461 (ELOVL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbi01004]
    103057461 (ELOVL1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     103057461 (ELOVL1)
Lipid biosynthesis proteins [BR:pbi01004]
 Elongase
  PUFA
   103057461 (ELOVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO DUF3139
Motif
Other DBs
NCBI-GeneID: 103057461
NCBI-ProteinID: XP_007442639
LinkDB All DBs
Position
Unknown
AA seq 287 aa AA seqDB search
MDVLVNRYRDFMKGADPRIGTYPLMDSPWLMTGILLSYVYFVLSLGPRLMANRKPLNLKK
FMIFYNFFLVALSLFIVYEFLMSGWLNGYTWRCDPVDTSQDPRALRMVRVAWIFIFSKII
ELMDTVIFILRKKNEQVTFLHVFHHSVLPWSWWWGVKFGPGGMGSFHALVNSMVHVVMYF
YYALSAAGPAFQKYLWWKKHITAIQLLQFVIVSIHISQYYFMPTCNYQFPIFIHLIWIYG
VIFFILFSNFWYQSYTKGKRLPKTMTQPQQNGFHENGAIANGKVKAN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgttggtgaacagatatcgagacttcatgaagggagcagacccccggattggt
acatacccacttatggattctccttggctcatgacgggtatcttactgagctatgtctac
tttgtattatcgctgggcccacggctcatggccaacaggaaacctctgaaccttaagaag
ttcatgattttttataatttttttttggtagcactgtcactcttcattgtttatgagttt
ctaatgtcaggctggctgaatggttatacatggaggtgtgaccctgttgatacatcccag
gatcccagggctcttcggatggtccgtgtggcatggatcttcattttctccaaaatcatt
gaactgatggatacagtgatctttatcctaaggaaaaagaatgaacaagtgacctttttg
catgtgttccaccattcagtgctaccttggagctggtggtggggtgtgaagtttggtcca
ggaggaatgggctccttccatgctttggtgaactctatggtacatgttgtgatgtacttt
tattatgcgctctcagctgcagggcctgctttccaaaagtacctgtggtggaagaagcac
atcactgccattcagttgctgcagtttgtgatcgtctccatccatatctcccagtactac
ttcatgcctacctgcaattaccagttcccaatcttcatccacctcatctggatttatggc
gttatcttcttcattctcttctccaacttctggtaccagtcatacaccaaaggcaagcgt
ctgcccaagaccatgacacaacctcagcaaaatggcttccatgagaatggtgccattgct
aatggcaaagtcaaagccaactag

DBGET integrated database retrieval system