KEGG   Python bivittatus (Burmese python): 103057562
Entry
103057562         CDS       T03091                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04060  Cytokine-cytokine receptor interaction
pbi04068  FoxO signaling pathway
pbi04144  Endocytosis
pbi04218  Cellular senescence
pbi04350  TGF-beta signaling pathway
pbi04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103057562 (TGFBR2)
   04350 TGF-beta signaling pathway
    103057562 (TGFBR2)
   04068 FoxO signaling pathway
    103057562 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103057562 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103057562 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    103057562 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103057562 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103057562 (TGFBR2)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     103057562 (TGFBR2)
Protein kinases [BR:pbi01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   103057562 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase TMEM154 APH Orf78 DAG1
Other DBs
NCBI-GeneID: 103057562
NCBI-ProteinID: XP_007422895
LinkDB
Position
Unknown
AA seq 561 aa
MSWIPKHVLLWTLLHSTAHPLGRGTAEHREHSMFSGGFKMRKLCKFCDVKLTTCTNEGHC
CSNCNITAICEGENEICAAVWRKNNGNITLETICHDPMLKLHGYKLDDFNSKKCIMKEKK
GVGGLLFMCSCKDDECNDEIIFSENTTSSTEVKYVILLVAVICLVPLLVIAIAVIIIFYF
YRVQRRRKLNKAWEKNVKSRKHKDCSDVCAIMLDDDRSDISSTCANNINHNTELLPIELD
TLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFSYEEYASWKTEKDIFSDINLKHENILQF
LTAEERKTDLGKQYWLITAFHSRGNLQEYLIKHIISWEDLWKLGGSLARGIAHLHSDHTP
CGRLKTPIVHRDLKSSNILVKNDLACCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAP
EVLESRMNLDNVESFKQTDVYSMALVLWEMTSRCNGVGAEVKDYEPPFGSKVREHPCVES
MKDNVLRDRGRPEIPSSWLNHQGIQKVCETIVECWDHDPEARLTAQCVAERFNDFEYQDR
LSGRSSSEEKIAEESSGNSAK
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgagctggattcctaagcacgttttgttgtggactctcctgcacagcacggctcacccg
ctgggacggggaacagctgagcatcgtgaacatagcatgttcagtggtggattcaaaatg
cggaaattgtgcaagttttgtgatgttaaattaacaacctgcaccaacgaaggtcattgt
tgcagtaactgcaacatcactgctatttgtgaaggcgagaatgaaatctgtgcagctgtt
tggagaaagaataatggaaacataactctagaaacaatatgccatgaccctatgctaaag
ctccatggatacaaattggatgatttcaattcaaaaaaatgcatcatgaaagaaaagaaa
ggagttggaggactgctatttatgtgttcctgcaaagatgatgaatgcaatgatgaaatt
attttttcagaaaataccacctcaagtacagaagtaaaatatgtgatacttttggtcgca
gttatatgccttgtcccgttgctggtgattgccattgctgtgatcattatattttacttt
taccgtgttcagaggaggaggaagctcaacaaggcatgggagaaaaatgtgaagtccagg
aagcacaaagactgtagtgatgtttgtgccattatgttggatgatgatcgctctgatatc
agttctacgtgtgctaataatattaaccataataccgaattgctgcccattgagttggac
actttggtaggcaaagggcgatttgcagaagtctataaggctaaactgaaacaaaataca
tcagaacagtttgaaacagtggctgtcaagatcttctcctatgaagaatatgcctcctgg
aagactgagaaagacatcttttctgacataaatttaaaacatgagaatatcctacagttc
cttacagcagaggagcgcaagacagatctaggcaaacaatattggttgatcactgctttc
cattcaagaggcaacttgcaggagtacctcataaaacacataattagctgggaggatctc
tggaaactgggtggctctttggctcgtgggattgcccaccttcatagtgaccacacacct
tgtggccgactcaagacacctattgtccacagagacctgaagagctccaatatcctggta
aagaatgatctggcctgctgtctttgtgactttgggctgtcgctgcggctggatccaact
ctctcagttgatgacctggccaatagtgggcaggttggtacagcaagatacatggctcct
gaagtcctggaatccagaatgaacttggataatgttgaatccttcaagcagactgatgtg
tattccatggctttggttctgtgggaaatgacatctcgctgcaatggtgttggagcagag
gtgaaagactatgagccaccatttggttcaaaagtgcgagaacatccgtgtgtagaaagc
atgaaggacaatgttttgagggacagaggacggccagagattcctagctcatggctcaac
catcagggtatccagaaggtgtgcgagaccattgttgagtgttgggatcatgatcctgag
gcccggctgactgcgcagtgtgtagctgagaggttcaatgattttgagtaccaagacaga
ctctcgggaagaagcagttcagaagagaagatcgctgaagagagctctggcaacagtgcc
aagtaa

DBGET integrated database retrieval system