KEGG   Python bivittatus (Burmese python): 103057741Help
Entry
103057741         CDS       T03091                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00512  Mucin type O-glycan biosynthesis
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103057741 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbi01003]
    103057741 (GALNT9)
Enzymes [BR:pbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103057741 (GALNT9)
Glycosyltransferases [BR:pbi01003]
 O-Glycan biosynthesis
  Mucin-type
   103057741 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 103057741
NCBI-ProteinID: XP_007426165
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSQELVQIVRSADRRMRGRNAKVGALLD
REAILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKEMSYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SHLLKEIILVDDNSDNVELKFNLDQYVHKRYPGLVKIVRNNKREGLIRARIQGWRASTSP
IVGFFDAHVEFNNGWVEPALTRIKEDRKRIVLPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIP
MTNPGVDFGDVSERVALRQRLQCRSFKWYLENVYPEMRVYNNTITYGEVRNSKASGYCLD
QGAEDDNKAILYPCHGMSSQLVRYSTEGLLQLGPLGSTAFLPDSKCLIDDGKGRTPALKK
CEDTLRPAQRLWDFTQNGPIINRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggttgcaaggaaaatcaaaactttgttgacagtgaacatcttggtctttgtgggc
atcatcctcttctcagtctactgcaggatccaggaccgctcccaggagctggtgcagatt
gtccggagcgctgaccgacggatgaggggacggaatgccaaggtgggcgccctgctggat
agggaggccattctgcaacggttggatcatctggaggaggtggtgtacaaccaactcaat
ggtctagccaagccaatgggattagttgaaggccctggaggtttgggccaaggaggaatg
gctgccacactgagagatgatagccatgaatctgaaactaaatatgaagaatatggttac
aatgcccaactaagcgatcggatttcattggacagatctattccagactatagacccaaa
aagtgcaaagagatgtcttatcctgatgatcttccccagatctcggtggtcttcattttt
gtaaatgaagccttgtcggtcatcctgcgctcagtccacagtgttgtgaatcacacccca
tcccacttgctcaaggagatcattctggtggatgacaacagcgacaatgttgagctgaag
tttaatttggatcaatatgttcataaaagatatccaggtctggtgaaaatagttcgcaat
aacaaacgggaagggctgatccgagctagaatccaaggctggagagcttcaacatctcca
attgttggtttttttgatgctcacgtggaattcaacaatggctgggtagagccagccttg
acacggattaaagaggaccgcaaacggattgtcctcccagcgatagacaacatcaagtac
aatacgtttgaagtgcaacagtacgccaacgctgctcacggctacaactggggactctgg
tgcatgtacatcattccaccgcaggactggctggacagaggagatgaatctgcacccatc
aggacaccagccatgattgggtgttcgtttgtggtggatagagagtactttggtgagatc
ggcctgcttgatcctggaatggaggtttacggaggagaaaatattgaactcggtatgagg
gtctggcagtgtggcgggagcatggaagtcctgccttgctcccgggtggcccacattgag
cgcactaagaagccttacaacaacgacatcgactattatgcaaagcgcaatgccctgcgc
gctgctgaagtttggatggatgacttcaagtcccatgtgtacatggcatggaacatacca
atgacgaaccctggagttgactttggagatgtttctgaaagggttgctttacggcagcgt
cttcagtgccggagttttaagtggtacttggagaatgtctatcctgaaatgagggtttac
aataataccatcacatatggagaggtacgcaacagcaaagctagtggctactgcctggac
cagggagcagaagatgacaataaagcgatcctctatccctgccacggcatgtcctcccag
cttgtccgttacagcaccgaaggattgttgcagctgggcccgctgggatccaccgcgttc
ctacctgactcaaagtgtctcatagatgatgggaaaggaaggacccccgcgctgaagaaa
tgcgaagacacgctgagaccagcccagcgactctgggatttcacacagaatgggcccatc
atcaaccgagatactggccggtgtctggaagtagaaatgtctaaggatgccaattttgga
ctcagattagtagtacagagatgctcgggtcaaaaatggatgatcagaaactggataaaa
cacggaagacattga

DBGET integrated database retrieval system