KEGG   Python bivittatus (Burmese python): 103058373Help
Entry
103058373         CDS       T03091                                 

Gene name
GYS2
Definition
(RefSeq) glycogen [starch] synthase, liver
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00500  Starch and sucrose metabolism
pbi01100  Metabolic pathways
pbi04910  Insulin signaling pathway
Module
pbi_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103058373 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103058373 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbi01003]
    103058373 (GYS2)
Enzymes [BR:pbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103058373 (GYS2)
Glycosyltransferases [BR:pbi01003]
 Polysaccharide
  Storage polysaccharide
   103058373 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 103058373
NCBI-ProteinID: XP_007427449
LinkDB All DBs
Position
Unknown
AA seq 664 aa AA seqDB search
MVGGICTVIQTKAKTTLDEWGENYFLIGPYFEHNVKMQVEVCEPPSAAVKKAMDVIKANG
YQVYFGRWLIEGSPYVVLFDIASAAWNLDRWKGEFWEASHVGIPYHDREANDALIFGSLT
AWFLTELANQFEEKPNVIAHFHEWQAGPGLILCRFKKIPVATIFTTHATLLGRYLCAASI
DFYNHLDQFDIDKEAGEREIYHRYCMERASVHCAHVFTTVSQITAIEAEHMLKRATDVIT
PNGLNIKKFSAMHEFQNLHATYKARIQEFVRGHFYGHLDFNLERTLFFFIAGRYEFSNKG
ADMFLEALSRLNFLLRVHRSDVTVVVFFIMPANTNNFNVETLKGQAVRKQLWDTAHSVKE
KFGKKLYEALLRGEIPDMNKIIDRDDLTIMKRAIYSTQRQSLPPVTTHNMIDDSGDPILS
TIRRIGLFNNRTDRVKVILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAE
CTVMGIPSVTTNLSGFGCFMQEHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQS
RRQRIVQRNRTERLSDLLDWRYLGRYYMHARHLALSRTFPDKFEMEPNAPPKTEGFRYPR
PSSVPPSPSISQHNSPHQSDEEVEDDERYDEEEEAERDRQNIKSPFSFSAMPRGKKKQHG
EYRN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggttggtggcatctgcacggtgatccagacgaaagccaaaaccaccttagatgaatgg
ggggaaaactactttctcattggcccttattttgagcacaatgtaaagatgcaagtggaa
gtctgtgagcctcccagtgcagcagtgaagaaagctatggatgtgataaaagccaatggg
tatcaggtctattttggaaggtggctgattgaaggaagcccatatgtggtgttgtttgat
atagcatcagcagcttggaatctggacagatggaaaggggaattctgggaagccagccat
gttggaattccttaccatgacagagaagcaaatgatgctctcatctttggatcgctaact
gcctggtttctgacagagcttgccaatcagtttgaagaaaagcccaatgttatagctcac
ttccatgaatggcaagcaggaccgggcctcatcctgtgccgattcaagaagattccagtt
gcgaccattttcacaactcacgcaacactgttaggaagatatctgtgtgcagcaagcata
gacttctacaatcatttggatcagtttgatatagataaagaagcaggggaaagagagata
taccacagatactgcatggaacgggcatcagtgcattgcgcgcatgtctttaccacggtc
tctcagataactgccatagaagcagagcacatgttgaagagagcaactgatgttatcacg
cccaacggcctcaacattaagaaattctcagctatgcatgaatttcagaatttgcacgcc
acctataaagctaggatccaagagttcgttcgaggacatttctatggccatcttgatttc
aaccttgagaggaccttgtttttcttcattgctgggagatacgagttttcaaacaaagga
gctgacatgtttttagaggccttatcaagattaaatttcctactaagggtgcacagaagt
gatgtcacggttgttgtattctttataatgccagcaaataccaacaatttcaacgtggag
accctgaaaggccaggcagtccggaaacagctatgggacaccgcacattcagtgaaggaa
aaatttggtaagaaactctatgaagcattgctaagaggagaaattcctgatatgaacaag
atcatagatcgtgatgacctaactattatgaaacgagccatctattccacccagcggcag
agcctcccaccagtgacaacacacaacatgattgatgactccggcgacccaatcctcagc
accatcagacgtattggtttgttcaataatcgaactgatcgagttaaggtcatcctgcat
ccagaatttctttcctcaactagtccattattaccgatggactatgaagaatttgtcaga
ggttgccatcttggggtcttcccgtcatattatgaaccctggggttatactccagctgaa
tgcaccgtcatggggatccccagtgttaccacaaacttgtctggattcggttgtttcatg
caggagcatgtagccgacccggctgcttatggcatttacattgtggaccggcgattccgt
tctccagatgaatcttgcaatcagctgacccagttcctgtatggattctgccaacagtca
cgacggcaaagaattgtccagagaaaccgtacagaaaggctttcagatctgctggactgg
agatatttagggcgatattatatgcatgccagacacttagctctgagtcggacttttcct
gacaaatttgagatggaaccaaatgctccacccaagacagaaggtttccgttatccacgt
ccttcatctgtccctccctcaccttccatttctcagcacaacagccctcaccaaagtgat
gaggaagttgaagatgatgaaagatatgatgaggaggaagaggctgagagggataggcaa
aacataaagtctcccttctccttcagtgctatgccaagggggaaaaagaaacagcatggg
gaatacaggaactaa

DBGET integrated database retrieval system