KEGG   Python bivittatus (Burmese python): 103058787Help
Entry
103058787         CDS       T03091                                 

Gene name
POMGNT1
Definition
(RefSeq) protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1
  KO
K09666  beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.-]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00515  Mannose type O-glycan biosynthesis
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    103058787 (POMGNT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbi01003]
    103058787 (POMGNT1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     103058787 (POMGNT1)
Glycosyltransferases [BR:pbi01003]
 Glycan extension
  O-Glycan
   103058787 (POMGNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GNT-I ILEI
Motif
Other DBs
NCBI-GeneID: 103058787
NCBI-ProteinID: XP_007435638
LinkDB All DBs
Position
Unknown
AA seq 657 aa AA seqDB search
MMDEWKPNLQPKPWKKRSWYLAWKYKLTNQRALRRLCQMGAVLFLLVTVIVNIKLILDTR
RAASEEEESAQDYDESLQKLEIPRRPVSNRKVLDIEVYSSRSKVYVAVDGTTVLEDEARE
QGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAKGRILIFTIKDEGSFHLK
DTAKSLLKSLGSQIAASLSWRDMWTFVGKKGGEVYGEKHAKSPVLSSWGEPVLLKTEVQL
TSVEDAECHWPDTELNRRRKHFCSKVEGYGSVCSCKDPTPIEFNPDPLKDNKVFDVPVAV
IAGNRPNYLYRMLRSLLSAQGVNPQMITVFIDGYYEEPMDVVELFGLKGIQHTPISIKNA
RVSQHYKASLTATFNLHPDAKFAVVLEEDLDISIDFFSFLSQSIYLLEEDDSLYCISAWN
DQGYEHTAEDPSLLYRVETMPGLGWVLRKTLYKDELEPKWPTPEKLWDWDMWMRMPEQRK
GRECLIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPSVQLKNVESLKKDAYEIELH
RLLSEAEVLDHSKNPCEDSFVPDTEGKTYVMYIKMEQEADFTTWTQLAKCLHIWDLDVRG
NHKGLWRLFRKKNHFLVVGVPASPYSFKKPPSVTPIYMEPQAKDEAAGAIAAGAEQT
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgagtggaagcctaacctgcaacccaagccgtggaagaaacgcagctggtat
ttggcctggaagtacaagctgacaaatcagagggcactcaggagactgtgtcagatggga
gctgtacttttcttgctggtaactgttattgtgaacataaagctgatcttggacactaga
agagcagccagtgaagaagaagaatcagctcaggattatgatgaaagtttgcagaagcta
gagatccctcggcggcctgtcagtaatagaaaagttctggacatagaggtgtattccagt
cgctccaaggtttatgttgcagttgatgggaccacggttttagaagatgaagcacgggaa
caaggcagaggcatccatgtcattgtgttaaatcaggctacaggccacgtgatggcaaag
cgggtttttgacacctattccccccatgaggatgaggccatggtcctcttcctcaacatg
gtggccaagggtcgcattcttatcttcacaattaaggatgagggctccttccaccttaaa
gacacagccaagagtcttctgaagagtttagggagccagattgcagcttccctcagctgg
agggacatgtggacctttgtggggaagaaaggaggtgaagtctatggcgagaaacatgcc
aagtccccagtgctttcctcatggggagagccagttttgctgaaaactgaagtccaatta
acctctgtggaagatgcggaatgccactggccagatactgagttgaatcggcggcggaag
catttttgcagcaaagttgaaggttatggcagtgtctgcagctgtaaagatcctacacct
atagagttcaatcctgatccactcaaagacaacaaagtttttgatgtgcctgttgctgtc
atcgcagggaacagacccaactacctgtacaggatgctacgatctctgctgtcagcacaa
ggggtcaatcctcaaatgataacagtttttattgacggatattatgaggagccaatggat
gtggttgaattatttggcctgaagggaatccagcacacccccatcagcattaaaaatgca
agagtctctcagcactacaaagccagtttgactgcaacattcaacttgcatccggatgct
aagtttgctgtggtactggaagaagacttagatatttccattgatttcttcagcttccta
agccagtctatctatttgctggaagaagatgacagcttatactgcatctctgcctggaat
gaccaggggtatgaacatactgctgaggacccttcactgctgtatcgtgtagagactatg
ccaggcctgggctgggtgctaagaaagactttgtataaggatgaattggagcctaagtgg
ccaacaccagagaagctttgggactgggacatgtggatgcgcatgccggagcagcggaaa
ggccgcgaatgcctcatcccagacgtatcgcgctcgtatcactttggcattgttggcctc
aacatgaatggctacttccacgaagcctatttcaaaaagcacaagttcaacacagtcccc
agtgtacagcttaagaatgtggagagtttaaagaaagacgcatatgaaatcgaacttcat
cgtctgctcagtgaggctgaagttctggatcacagcaagaatccttgtgaggattccttt
gtcccagacactgaaggaaaaacctatgtgatgtacatcaagatggagcaggaggcagat
ttcactacttggactcagcttgccaagtgcctccacatctgggacctggatgtccgaggg
aatcacaaaggactatggcggctgtttcggaagaagaaccacttcttggttgtaggagtc
cctgcctctccatattcattcaaaaaacctccttcagtgaccccgatctacatggagccc
caagccaaggatgaggcagcaggagccatagcagcaggagcagagcaaacgtga

DBGET integrated database retrieval system