KEGG   Python bivittatus (Burmese python): 103058912
Entry
103058912         CDS       T03091                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04141  Protein processing in endoplasmic reticulum
pbi04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103058912 (ATF6B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103058912 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pbi03000]
    103058912 (ATF6B)
Transcription factors [BR:pbi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103058912 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf YabA DUF4407 Docking
Other DBs
NCBI-GeneID: 103058912
NCBI-ProteinID: XP_007444012
LinkDB
Position
Unknown
AA seq 636 aa
MDSGGTHSMQFNDGFDLDMETMPPDPPWDPLQESLFPELQVKSEPVSPASSHCSDSSVGS
SDSSAACSSSAELSEQVPGPADVIGVKTEHPPTPPCMFGDVLLPPFGTVHINVVPTSETG
KPGAPNKAESILSRKPPIQPKPVVVTTVPGQPATTSSKTILLQPVPVTQSQTTNPGISVP
AQSVVISQSELLHLPVSGLIKVQSPVKEVLPPKPAPSVPKPEAKAIIPAPTQIGPCNQEI
DIKVLKRQQRMIKNRESACQSRRKKKEYLQGLESRLREALAENERLRRENAALRRRLDGV
LDENSELKFGSGNRKVICVMVVLLFIAFNFGPVSITEHKAADVSQPKQELESGPGQRHLL
TITQEAVEVPEEEQEEQQEETLARPGKAQFRNLSAPFSDMKDLMLRDLDELFLASDCRQF
NRTESLRLADELSGWVRRHQINRRKPLQTRKAAKGSQDKPQRKPPSPSRYVPASPPKYPE
RDSLSQLQVYQHPDHTEHDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVM
PAMALNESLYGSSLGYEVMMQVDCEVMDTRVIHIKSSTVPPFLRRQGTTSDNRTQPSPPA
FSGRTPRTTLRSHRPTLPSARRHSHRTLYLGEHGGG
NT seq 1911 nt   +upstreamnt  +downstreamnt
atggacagtggcggtacccattctatgcagttcaatgatgggtttgatctggacatggaa
actatgcctccagacccaccttgggatcctttgcaagaatctctgttcccagagctgcag
gtaaagtctgagccagtctcccctgcctcatcgcactgctctgattcatccgtgggctcc
tccgattcatctgctgcgtgctcctcttctgcagaactctcagagcaggtccctggacca
gctgatgtgattggagtgaagacggagcatcccccaacccctccgtgtatgtttggagat
gtccttttacctccctttggaactgtacacataaatgtagtcccaacttctgaaacaggg
aaaccaggggctcccaataaagcggagagcattctgagtcggaaaccccccattcagcca
aagccggttgtggtgaccactgtcccaggacagccagcaaccacttccagtaagaccatc
ttgttgcagcctgtgcctgtgacccagtcacagaccaccaaccctggaatctcagttcca
gcacaaagtgttgtgatttcccagtctgagctgctgcatctccccgtgtctggtttgatc
aaggttcagtcccctgtgaaggaagttctcccacctaagccagccccctcagtccccaag
ccggaggctaaagcgatcatccctgcaccgacacagataggaccctgcaaccaggagatt
gatatcaaggtcctgaaaaggcagcagcggatgataaagaaccgtgaatcagcatgtcag
tcccgccgaaaaaagaaggaatatctccaaggattggaatcccggctgcgagaggccctg
gcggagaacgaacggctgcgacgggagaatgctgcccttcggcgccggctagatggtgtc
ctggacgagaacagcgagctgaagtttggctccgggaaccgaaaagttatctgtgtcatg
gttgtgctgctcttcatagccttcaattttgggcctgtcagcattaccgaacacaaggct
gcagatgtgtctcagcccaagcaggaactggagtctggcccaggccagaggcatcttcta
accattacacaagaagctgttgaagtgccagaggaggagcaggaggaacagcaagaggag
accctggcaaggccaggcaaggcccaattccggaacctgtcagctcccttctcagatatg
aaggacctcatgttgagggacctggatgagctgttcctcgcttcagattgccgtcaattc
aatcgcactgaatcgctccggttggcagatgagctcagcggctgggtccgacgacaccag
atcaaccggaggaaacccttgcaaactcgcaaagcagctaagggcagccaggacaagcca
caaaggaagcctccaagcccttcccgctatgttccagccagcccccccaaataccctgag
agggattctctgagtcagttacaggtgtaccagcatcctgaccatacagagcacgacttc
atggatgccattgaccgccgagaggatactttttacgttgtgtccttccgcagggatcac
ttgctgctgcctgccatcagccacaacaagacctcccgccctaaaatgtccctggtgatg
cccgccatggctctgaatgagagcctctacggctcctccctgggctacgaagtcatgatg
caggtcgactgtgaggtcatggacacccgcgtcatccacatcaagagctccacggtgccc
cccttcctgagacgccaaggcaccacttctgacaaccgcacccagccgtccccgcctgcc
ttttctggaaggaccccccgtacaactttgcgctcccatcgccccactttgccctcagcc
cggcggcattcccatcgcactctctacctcggggaacacggagggggctag

DBGET integrated database retrieval system