KEGG   Python bivittatus (Burmese python): 103059167Help
Entry
103059167         CDS       T03091                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103059167 (GPD2)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103059167 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 EF-hand_8 FAD_oxidored GIDA Pyr_redox_2 EF-hand_9 FAD_binding_3 EF-hand_5 NAD_binding_8 HI0933_like Dockerin_1 Pyr_redox_3 EF-hand_4 EF-hand_10
Motif
Other DBs
NCBI-GeneID: 103059167
NCBI-ProteinID: XP_007424095
LinkDB All DBs
Position
Unknown
AA seq 727 aa AA seqDB search
MAFRKAMKGTILIGGGAVATVFALSQLSQYRKKHGHLVSVEASECRLSPILRSLPTRENH
LQALRETDEFDVLIIGGGATGSGCALDAVTRGLSTALVERDDFASGTSSRSTKLIHGGVR
YLQKAIMNLDFEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSHCLKSSYVLSKSRALELFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYTEVVRLLKKMDPESGKSQVCGARCRDVLTGQEFDVKAKCVINATGPFTDSVRKM
DEQEVPNICQPSAGVHIVMPGYYSPDNMGLLDPSTSDGRVIFFLPWQKMTIAGTTDTATE
VTHHPIPTEEDINFILTEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSISRNH
VVHISDSGLVTIAGGKWTTYRSMAQDTIDAAVKAHKLQADPCKTVGLLLQGAEGWSPTLY
IRLVQDYGLESEVAQHLANTFGDKAFEVAKLAQVTGKRWPIVGKRLVSEFPYIESEIEYA
VSEYACTAVDIIARRTRLAFLNVQAADEALPRIIEIMGKKLRWSEQKKKEELAVAKKFLY
YEMGYKARSEQLTDRSEITLTPADIERYKKRFHMFDKEGKGFITILDVQRVLESINLQIN
ESALHEILNEVDLNKNGQVELNEFLQLMTAIQKGYVSGSRLAVLMKAAEENIHQREVISV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcgaaaggcaatgaaaggaactatccttataggaggaggtgctgtagcaact
gtgtttgccctctcacaactttctcaatatagaaaaaagcatggtcatcttgtatctgtg
gaagcttcagaatgtagactttcaccaatactgcgctcccttccaactagagagaatcat
ctccaggctttgagagaaaccgatgaatttgatgttcttatcataggtggaggtgccaca
ggaagtggttgtgccttagatgctgttacaagaggcctcagcacagcccttgtagaaagg
gatgatttcgcatcagggactagcagcagaagtactaaactgatccatggtggagtgaga
tacctacagaaggccatcatgaacttggattttgagcagtatagaatggtgaaagaagcc
ctccatgaacgtgccaacttgcttgaaattgcacctcatttatctgctcctctacctata
atgcttccagtatacaagtggtggcaactgccctattactgggtgggaattaaactgtat
gaccttgtagcaggaagccactgtctgaaaagcagctatgtgcttagcaaatcaagagcc
ttggagctctttcctatgttgcagaaggacaaactcgtgggtgccatagtctactatgat
ggacaacacaatgatgcacgaatgaaccttgccatcgccctcaccgctgccaggtatggg
gctgccacagccaattacactgaagtggtgcgcttgctgaagaagatggatccagagagc
gggaagagccaggtttgtggagcaaggtgcagggacgttctaacagggcaggaatttgat
gtcaaagccaaatgtgttatcaatgctacaggacctttcacagattctgtgcggaaaatg
gatgagcaggaagtaccaaacatctgtcagccaagtgcaggcgttcatattgtgatgcct
ggctattacagccctgataatatgggacttcttgacccatctactagtgatggacgagtg
attttcttcttaccatggcaaaagatgactattgctggcactacggatactgcaactgaa
gttacccatcacccaatacctacagaagaagatatcaacttcattttgacagaagtgcgc
aactatcttagctgtgatgttgaagtgaggagaggagatgttctggcagcatggagtggg
attcgtccccttgtgactgatcccaattctaaagacacccagtccatatctcggaatcac
gtggtacacattagtgacagcggccttgtgactatcgcaggtgggaagtggacaacttat
cgctcaatggcccaggataccattgatgctgcagtaaaagctcataagcttcaggccgat
ccctgtaaaactgtaggactgctcctgcagggcgcagagggctggagccctaccctttat
atccgactggttcaagattatggacttgaaagtgaggtggctcaacatcttgccaataca
tttggggacaaggcttttgaagtggcaaaactagcccaggtaactgggaagagatggcct
atcgttggaaaacgtcttgtctcagagtttccatatattgagtcagagattgagtatgcc
gtcagcgaatatgcttgcactgcggtggacataattgctcgtcgcacccgtttggctttt
ctgaatgtccaagctgctgatgaagccttaccgagaatcattgagataatggggaagaaa
ctaagatggagcgaacagaagaagaaggaagagcttgcagtggcaaaaaagttcctgtac
tatgaaatgggctacaaggcacggtcggagcaactgacagatcggagtgaaatcacttta
accccagcagatattgagaggtataaaaaaagattccacatgtttgataaagaaggcaaa
ggttttattacaatattggacgtgcagcgtgtgctagagagcatcaaccttcaaattaat
gaaagtgcactccatgagattttgaatgaagtggatttgaacaaaaatgggcaggttgaa
ctcaacgagtttttgcagctcatgactgctattcagaaaggatatgtgtctggaagccgg
cttgctgtacttatgaaagcagctgaagagaacattcatcagcgggaagtaatttcagtg
gaccggagttgtggtggactgtga

DBGET integrated database retrieval system