KEGG   Python bivittatus (Burmese python): 103059990Help
Entry
103059990         CDS       T03091                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00562  Inositol phosphate metabolism
pbi01100  Metabolic pathways
pbi04068  FoxO signaling pathway
pbi04070  Phosphatidylinositol signaling system
pbi04115  p53 signaling pathway
pbi04140  Autophagy - animal
pbi04150  mTOR signaling pathway
pbi04218  Cellular senescence
pbi04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103059990
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103059990
   04070 Phosphatidylinositol signaling system
    103059990
   04150 mTOR signaling pathway
    103059990
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103059990
  09143 Cell growth and death
   04115 p53 signaling pathway
    103059990
   04218 Cellular senescence
    103059990
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103059990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbi01009]
    103059990
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     103059990
    3.1.3.48  protein-tyrosine-phosphatase
     103059990
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     103059990
Protein phosphatases and associated proteins [BR:pbi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    103059990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 103059990
NCBI-ProteinID: XP_007433696
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDRWLSEDGNHVA
AIHCKAGKGRTGVMICAYLLHRGRFQKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVYQLKVKIFTSSSGPTRREDKYMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKGKQNRMSQ
NT seq 826 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatcatcaaagaaatcgtcagcaggaacaaaaggcgataccaggaggatggc
ttcgatttagatctgacttatatttatccaaatatcatcgcaatgggttttcctgcagaa
cgacttgaaggagtgtacagaaacaatattgatgatgttgtaaggtttctggattcaaaa
cataaaaaccattacaagatatacaatctgtgtgctgaaagacattatgacaccgccaaa
tttaactgcagagttgcacagtatccttttgaagaccacaacccaccacagctagagctc
atcaaacctttttgtgaagatcttgatcgatggcttagtgaagatggcaatcatgttgca
gcaatccactgtaaagctggaaagggacgaactggtgtaatgatttgtgcttatttgtta
catcgaggaaggtttcagaaggcacaagaagccctagatttctatggggaagtaaggacc
agagataaaaagggagtaactattcccagtcagagacgctatgtatattattatagctac
ctgttaaagaatcatctggattacagaccagtagcactgctgtttcataaaatgatgttt
gaaacaattccaatgttcagtggcggcacttgcaatcctcagtttgtggtctaccagctt
aaggtaaagatattcacctcctcttcaggacctacaagacgtgaagacaaatacatgtac
tttgaattccctcagccgttgccagtgtgtggtgatatcaaggtggaattcttccataag
caaaacaaaatgttgaaaaagggaaaacaaaatcggatgtcacaag

DBGET integrated database retrieval system