Python bivittatus (Burmese python): 103060382 Help Entry 103060382         CDS       T03091                                  Symbol MYL5 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism pbi  Python bivittatus (Burmese python) Pathway pbi04510   Focal adhesion pbi04520   Adherens junction pbi04810   Regulation of actin cytoskeleton pbi04814   Motor proteins pbi04820   Cytoskeleton in muscle cells pbi05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pbi00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103060382 (MYL5)    04520 Adherens junction     103060382 (MYL5)   09142 Cell motility    04814 Motor proteins     103060382 (MYL5)    04820 Cytoskeleton in muscle cells     103060382 (MYL5)    04810 Regulation of actin cytoskeleton     103060382 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103060382 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pbi04812]     103060382 (MYL5) Cytoskeleton proteins [BR:pbi04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      103060382 (MYL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_4 EF-hand_11 UPF0154 Motif Other DBs NCBI-GeneID:  103060382 NCBI-ProteinID:  XP_007431998 UniProt:  A0A9F2QZY8 LinkDB All DBs Position Unknown AA seq 172 aa AA seqDB search MASRKTKKKEGGAKRAQRASSNVFSNFEQTQIQEFKEAFTLIDQNRDGFIDKEDLKDTYA SLGKVNVKDDELDAMLKEATGPINFTMFLNLFGEKLSGTDTEETILNAFKMFDPEAKGNI NKDYMKRLMMSQGDKFTAEEIDQMFQSSPIDSAGNLDYKALCYTITHGDEKE NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atggccagccgaaaaaccaaaaagaaggaaggcggtgccaagcgtgctcaaagggcttcc tctaatgttttctccaactttgaacagacacagatccaagaatttaaggaagctttcacc ctaattgatcagaacagagatggcttcatagataaagaagacctaaaagatacctatgca tcattgggtaaagtaaatgtcaaagatgatgaattagatgctatgcttaaagaagctaca ggacctattaatttcaccatgtttttgaacctatttggagaaaagttaagtggtacagat actgaagagactatactgaatgcatttaaaatgtttgacccagaagctaaaggcaatatt aacaaggattacatgaaacgcttaatgatgtcacaaggcgataagtttacagcagaagag atcgatcagatgtttcagtcctcccctattgactcggcaggaaatctggattacaaagct ctctgctacactatcacacacggagatgaaaaagaataa

DBGET integrated database retrieval system