KEGG   Python bivittatus (Burmese python): 103060610Help
Entry
103060610         CDS       T03091                                 

Gene name
PFKM
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00010  Glycolysis / Gluconeogenesis
pbi00030  Pentose phosphate pathway
pbi00051  Fructose and mannose metabolism
pbi00052  Galactose metabolism
pbi01100  Metabolic pathways
pbi01200  Carbon metabolism
pbi01230  Biosynthesis of amino acids
pbi03018  RNA degradation
Module
pbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103060610 (PFKM)
   00030 Pentose phosphate pathway
    103060610 (PFKM)
   00051 Fructose and mannose metabolism
    103060610 (PFKM)
   00052 Galactose metabolism
    103060610 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103060610 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbi01009]
    103060610 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pbi03019]
    103060610 (PFKM)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103060610 (PFKM)
Protein phosphatases and associated proteins [BR:pbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103060610 (PFKM)
Messenger RNA biogenesis [BR:pbi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103060610 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103060610
NCBI-ProteinID: XP_007424840
LinkDB All DBs
Position
Unknown
AA seq 825 aa AA seqDB search
MWLSLDLSVIGSSLFISVSLTFAAVIFLTYLFSEEEEEQSAQRMAQTPEKHEHCDTMGIG
KAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGLVDGGDNIKEATWESVSM
MLQLGGTVIGSARCLDFRKREGRLKAACNLVKRGITNLCVIGGDGSLTGADTFRSEWTSL
LQELVKTGNITVEEARKSSFLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTT
AQSHQRTFVLEVMGRHCGYLALITALASGADWVFIPESPPEDDWEDHLCRRLTETRTRGS
RLNIIIVAEGAIDRHGKPITSEDIKNLVVKRLGFDTRVTILGHVQRGGTPSAFDRVLGSR
MGVEAVMALLEGTPDTPACVVSLSGNQAIRLPLMECVQVTKDVTTAMGEGRFDDALKLRG
RSFLNNWNVYKVLAHVRPPSAKSGYNLAVMNVGAPAAGMNAAVRSTVRIGLIHGHKMLAV
HDGFEGLAEGRIEEIGWSGVGGWTGKGGSNLGTKRILPKKYFEEISNNIASFNIHGLIII
GGFEAFTGSLEMIEGRCKYEELCIPICVIPATVSNNVPGSDFSIGADTALNTITATCDRI
KQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIYEDPFTIHDLEMNVEHLTEKM
KTTVKRGLILRNEKCNENYTTDFIYNLYSEEGKGIFDTRKNVLGHMQQGGSPTPFDRNFG
TKMGAKAVAWMSGKIKECSRHGRIFANTADSACLLGMRRRALVFQPLTELKEETDFEHRI
PKSQWWLKLRPILKILAKYKIELDISEKAHLEHITRKRVSGEGAL
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtggctttcactggacctctcagtaatagggtccagtcttttcatttcagtctctctc
acatttgcagctgttatctttttaacctacttgttctccgaagaagaagaagaacaatca
gcccagagaatggcgcagacaccagaaaaacatgagcattgtgacaccatggggatcggc
aaggccattgctgtgttgacatctggaggcgatgcccagggtatgaatgctgctgtgcga
gctgtggtccgagtggggatatatactggtgccaaagtgtattttgttcatgagggttac
caagggcttgtggatggtggtgataacattaaggaagcaacatgggaaagtgtatctatg
atgctgcaactggggggcacagtaatcggaagtgccaggtgcctggacttccgcaaacgg
gaaggacgcctgaaagctgcttgcaacctggtaaagagaggaataaccaacctatgtgtg
attggtggtgatggtagtttgactggagcagacactttccgatcagaatggaccagtttg
ctacaggagctggttaagacagggaacatcaccgtagaagaagcaaggaagtccagcttc
ctgaacattgttggcatggttggctccattgacaatgacttttgcggcactgacatgacc
atcggtacagactctgctctccacaggataatggagatagtggatgccatcaccaccact
gcccaaagccatcagaggacatttgtgctggaggtgatgggacgtcactgtggttatcta
gcccttattacagccttggcgtctggtgcagactgggttttcattcccgaatctccacca
gaagatgactgggaggatcacttgtgcagaaggctaacagagacaagaactcgaggctcg
aggctgaacatcattattgtggctgaaggagcaattgatagacatggcaaacctatcact
tctgaagacattaaaaatctggttgtgaaacgcctgggttttgatacaagagtcaccatc
ttaggacatgtgcagcgtggtgggaccccctctgcctttgatcgtgttctgggaagcagg
atgggtgtggaagctgttatggccttgctggaaggcactccagataccccagcgtgtgtc
gtcagtctgtctggtaatcaagccatccgccttcctctcatggagtgtgttcaagtgacc
aaagatgtcacaacggcaatgggtgaaggacggttcgatgatgctctcaaactcagagga
aggagttttttgaataactggaatgtatacaaggttttggcccacgtgcgtccaccctca
gccaagagtggctacaatttggcggtgatgaatgtaggtgcaccagccgcaggcatgaac
gcagctgtgagatccaccgtcaggattggcttgatccatggacataagatgctggctgtg
catgatgggtttgagggccttgctgaagggaggattgaagaaatagggtggtcaggagtt
ggtggttggacgggaaaaggtggatcaaaccttggaaccaaaaggattctacccaagaaa
tactttgaggaaatcagcaacaacattgccagttttaatatccatgggctgattatcatt
ggtggttttgaggctttcactggcagcctggagatgattgaaggccggtgcaaatatgaa
gagctctgcatcccgatctgtgtgattcctgctactgtgtctaacaatgtgccaggctcc
gacttcagcattggtgcagacacggccctcaataccataacagcgacttgtgaccgcatc
aaacagtctgcagccggcaccaagcggcgggtcttcatcattgaaaccatgggaggctat
tgcggctacctggctactatggcaggcttagcagctggagcagatgcagcctacatttat
gaagaccctttcaccatccatgacttggagatgaacgtggaacatctgactgaaaaaatg
aaaaccacagtgaaaagaggcctaatattgaggaatgaaaaatgcaatgaaaattatacc
acagatttcatatataatttgtattcggaggaaggaaaaggtatctttgataccagaaag
aacgttttgggacacatgcagcagggtgggtcaccaactccatttgaccgaaactttgga
acaaaaatgggtgccaaagcagtggcgtggatgtctggcaagatcaaagagtgttccaga
catggtcgtatctttgccaacactgctgattcggcttgtctgctgggtatgcgcagacgg
gccctggtattccagcccctcacggaactcaaagaagaaacagattttgaacatcgcatc
cccaaatcgcagtggtggctgaagcttcgtcccatcttgaagattctagccaagtacaag
attgagcttgacatctcagagaaagcccacttggagcatatcactcgcaagagagtatct
ggcgaaggtgctctgtga

DBGET integrated database retrieval system