KEGG   Python bivittatus (Burmese python): 103060616Help
Entry
103060616         CDS       T03091                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00010  Glycolysis / Gluconeogenesis
pbi00051  Fructose and mannose metabolism
pbi00052  Galactose metabolism
pbi00500  Starch and sucrose metabolism
pbi00520  Amino sugar and nucleotide sugar metabolism
pbi00524  Neomycin, kanamycin and gentamicin biosynthesis
pbi01100  Metabolic pathways
pbi01200  Carbon metabolism
pbi04910  Insulin signaling pathway
Module
pbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pbi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103060616 (HK1)
   00051 Fructose and mannose metabolism
    103060616 (HK1)
   00052 Galactose metabolism
    103060616 (HK1)
   00500 Starch and sucrose metabolism
    103060616 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    103060616 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103060616 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103060616 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbi04131]
    103060616 (HK1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103060616 (HK1)
Membrane trafficking [BR:pbi04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103060616 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 103060616
NCBI-ProteinID: XP_007427557
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMGRFRNEMKNGLSRDFNPTAS
VKMLPTFVRSIPDGSEKGDFIALDLGGSFFRILRVKVSHEKKQTVQMETEIYETPEDIMH
GSGTRLFDHVAECLGDFMEKQEIKDKKLPVGFTFSFPCRQSKLDEGFLITWTKRFKASGV
EGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGLLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKLETKDVSAIEKSKEGLHKAKDILTRLG
VEPSHEDCIAVHHVCTIVSFRSANLIASVLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYSRRLHKTVRRLVPDSDVRFLLSESGSGKGAAFVTAVAYRLSEQHRLIDETLAEFKLT
NEQLLQVKKRMRMEMEAGLRKKSHDHAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRMVEMHNKIYSIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGACLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVNLLRDGIKRREEFELDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNVEMVEGDQGRMCVNMEWGAFGDNGCLDD
IRTIYDKAVDEYSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSRRAAQMCGAGMAA
VVDKIRENRGLEHLNITVGVDGTLYKLHPHFSRIMHQTAKELAPKCDVTFLLSEDGSGKG
AALITAVGCRLRDSEHN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctgctcagctactggcctattacttcaccgaactaaaggatgaccaggtcaaa
aagattgataaatatctatatgccatgcggctgtcggatgaaactttgctggatattatg
ggtcgcttccggaatgaaatgaagaatggcctctctagggattttaacccaacagccagt
gtaaaaatgctgcctacctttgtaaggtctattcctgatgggtcagagaaaggagatttc
attgctttggatcttggtgggtctttcttccgtattttaagagtgaaagtctctcatgag
aaaaagcagacggtgcaaatggaaactgagatttatgaaactcctgaagatattatgcac
ggcagtggaacacggctttttgatcatgttgctgaatgtctgggagactttatggagaaa
caagaaattaaggacaagaaattacctgttgggttcacattttcattcccatgtaggcaa
tctaaactagatgagggttttctgattacgtggacaaaacgtttcaaagcaagtggcgtc
gagggagctgatgtagtaaagctgttaaacaaagccatcaagaaacgtggggattatgat
gcagacatcatggcggtggttaatgacactgttgggacaatgatgacctgtggatttgat
gaccagcgttgtgaagttggcttaattattggtactggtacaaatgcctgctatatggag
gaaatgaggcacattgatctggtggaaggtgatgaagggcgcatgtgcattaatacggaa
tggggtgcctttggagatgacggcttattagaagacatccggactgaatttgacagagag
attgatcggggttcccttaatcctgggaagcaactatttgagaagatggtcagtggtatg
tacatgggtgaacttgtcaggcttatccttgtaaaaatggccaaagaaggtctccttttt
gaggggcgaatcactcctgaacttttaaccaaagggaaattagaaactaaggatgtttct
gccatagagaagagcaaagaaggtttgcataaagccaaagatatactgacacgtcttggg
gttgagccttcccatgaagactgcatcgctgtccaccatgtttgcaccattgtgtcgttc
cgctctgcaaacctgatagcaagtgttctgggtgctatcttgaatcagctgcgggacaat
aaaggagttggccggctacgtaccacggtgggggtggacggatccctttacaagatgcat
ccacaatactccagacgcctgcacaaaacagtgcgacgcttagtgcctgactctgatgtg
cgtttcttgctctctgagagcggcagcgggaagggggctgcctttgtgacagcagtagct
tatcggctgtcggagcagcaccggctgatcgacgagaccctggcagaattcaagctcacc
aacgaacagctgcttcaggtgaagaagcggatgaggatggagatggaggctggcctcagg
aagaagtcacacgaccacgccaaggtcaagatgctgcccacctttgtccgcagcacccct
gacgggacagagaatggagacttcctggctctggatcttggtggaacaaatttccgtgtt
ttgcttgtgaagatccgaagtggtaaaagaagaatggtggaaatgcacaataaaatctat
tcaattcctatagaagttatgcaagggactggagaagagctgtttgatcacattgtcacc
tgcatttcggacttcttggattacatgggaataaaaggagcttgtctccctctgggcttt
acgttttcttttccctgcaaacagaccagcttagatgctggcatccttttgaattggacc
aagggttttaaggctactgactgtgaaggagaggatgttgttaatttgctaagagatgga
attaaaagaagagaggaatttgaactggatgttgtggctgtagtgaatgatacagttgga
actatgatgacttgtgcctatgaagatccgaattgtgaaataggactcattgtgggaact
ggaagcaatgcgtgctacatggaggaaatgagaaatgttgaaatggttgagggagaccag
ggaaggatgtgtgtgaatatggaatggggtgcctttggggacaatggatgtctagatgac
attaggactatctatgacaaagctgtggatgaatattcgttaaatagtggcaagcaaagg
tatgagaagatgatcagtggaatgtatttaggggaaattgttcgtaacattttgatcgac
ttcacaaaaagaggattcctcttcagaggtcaaatttcagagacactgaaaactaggggc
atttttgaaaccaagtttctttcacaaattgagagtgataggttagcgttgcttcaggtc
cgtaccatcctccagcagcttggcctgaacagcacttgtgatgacagtataattgtgaag
acggtatgtggagccgtgtcacggagagccgctcagatgtgtggggctggaatggctgct
gttgtagataaaataagggagaacagaggcttggagcatctgaatataaccgtgggtgta
gatggtacactatacaagcttcatccacacttttcaaggatcatgcaccaaacggcaaag
gagctggcacccaaatgcgatgtgacattcctgctttcagaagatggcagtggcaaagga
gctgccctcatcaccgcggtgggatgccgactccgcgattctgagcacaactga

DBGET integrated database retrieval system