KEGG   Python bivittatus (Burmese python): 103061054Help
Entry
103061054         CDS       T03091                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103061054 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pbi03036]
    103061054 (HDAC4)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103061054 (HDAC4)
Chromosome and associated proteins [BR:pbi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103061054 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103061054
NCBI-ProteinID: XP_025028889
LinkDB All DBs
Position
Unknown
AA seq 844 aa AA seqDB search
MYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDSPVATALKKRPLDVTESA
CNSAPGSGPSSPNNSSSNISTENGVGSVANIHAETNLAHRPVNREGSITQLPLYTSPSLP
NISLGLPAAAPCTGGSGQQDSERLAIPSLQQRISIFPGTHITPYLSSTAVDREGGSTHSP
LLQHMVLLEQSTAQNPLVSGLGALPLHAQSLVGADRLSPSIHKLRQHRPLGRTQSAPLPQ
NAQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKMMPKSNEASRQHESHPEETEEELREH
QAFLEDQYIDRVANQKEIQGLTQMVHVKQEPAESDEDGEQQELEPGQRQAEQELLFRQQT
LLLEQQRIHQLRNYQASMEAAGIPVSFSGHRPLSRAQSSPASANFPLSTQETPCLVYDTL
MLKHQCICGNTNSHPEHAGRIQSIWSRLQETGLRSKCECIRGRKATLEELQTVHSEAHTL
LYGTNPLNRQKLDSRKLLGSLTSLFVRLPCGGIGVDNDTIWNEVHSFSAARLAVGCVVEL
VFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAISAKLLQQRLNVNKILIVDWDV
HHGNGTQQAFYSDPNVLYISLHRYDDGNFFPGSGAPDEVGIGLGVGFNVNIAFTGGLNPP
MGDPEYLTAFRTIVMPIAHEFAPDVVLVSSGFDAVEGHPAPLGGYNLSAKCFGYLTKQLM
GLAGGRIILALEGGHDLTAICDASEACVSALLGNELDPIPEKILQQTANVNAVHSIEKVI
EIHSKYWHSLQRYSSTVSYSLIDAQKCDNEEAETVTAMASLSVGVKPLPEKNLDEEPMEE
DPLL
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattccaaagatgattttccactcagaaaaacagcatctgagcccaatctcaaa
ttgcgatctagattaaagcagaaggttgctgaaaggcgcagcagtcctttgttaagacga
aaagatagtcctgtagctacagctcttaaaaaacgtccattagatgtcacagaatctgca
tgcaatagtgctcctggatctggtcctagttctccaaacaatagttccagtaatataagc
actgaaaatggagttggatcagttgcaaatattcacgcagagaccaacttggctcataga
cctgttaatcgtgaaggctcaataacacagcttccattgtatacatctccctcgttgcct
aatatatccttaggactacctgcagctgccccatgtactggtggatcaggacagcaagat
tctgaaagacttgctattccatcattacaacaacgaatctccatatttcctggcacccac
atcactccttatttgagcagtacagcagtggatagagaagggggatcgacacacagccct
cttctccagcacatggttttactggaacagtcaactgcacaaaatccattagtctcagga
ctaggggcactcccgctccatgctcaatctcttgtgggtgctgataggctgtctccctca
atacacaaactgcggcagcaccgccctctggggcgcacacagtctgctcctcttcctcaa
aatgcacaggccctccagcaattagtgatccaacaacaacatcagcaattcttggaaaaa
cacaaacagcaatttcagcagcagcagttgcacattaacaagatgatgccaaaatcaaat
gaggcttcccgtcagcatgaaagccatcctgaagagactgaagaagaattaagagaacat
caagcatttttggaagaccaatatattgacagggtagcaaatcagaaggaaattcaagga
ttgacccaaatggtccatgtgaagcaagaacctgctgaaagtgacgaagatggagaacaa
caagaattagaaccaggacaaaggcaagcagagcaggaactgctcttcagacagcaaact
cttctactggagcagcaacgtattcatcagctcagaaactatcaggcatccatggaagct
gctggcattccagtatcctttagtgggcatcggccactttctcgagcccagtcatcacct
gcttctgccaactttccattatctacacaggagacaccatgccttgtatatgacaccttg
atgctgaaacaccagtgcatctgtggaaacacaaacagtcacccagaacacgcagggaga
atccaaagcatttggtcacggcttcaggagacaggtcttcgtagcaagtgtgagtgcatc
cgtggaagaaaagcaactctagaagaattacagaccgtgcattcagaagcacacacactg
ctttatggtaccaaccctttgaacagacagaaattggacagcaggaaactgttaggctct
ctgacatcactgtttgtcagacttccatgtggtggcattggggtggacaatgatacaatt
tggaatgaagtgcattcattcagtgctgctcgtcttgctgttggctgtgtcgtagagctt
gtttttaaagtagctacaggagaactaaagaatggatttgctgtagttagacctcctggt
caccatgcagaagaaagtacgcctatgggtttttgctattttaactctgtggccatttct
gccaagcttctccagcagagattgaatgtgaacaaaatccttatagtggactgggatgta
catcatggaaatggtacccagcaagctttctacagtgatcccaatgtcctttatatttca
ctacatcgctatgatgatggaaacttcttccctggcagtggagcccctgatgaggttggc
ataggattgggtgttggtttcaatgtaaatatagcgtttactggtggtcttaatccacca
atgggagacccagaatacttgactgctttcagaacaatagtaatgcctattgctcatgag
tttgctccagatgttgtactggtgtcatcaggttttgatgcagtagaaggtcatcctgca
ccactcgggggatacaatctatcagcaaaatgctttggatacctgaccaaacagcttatg
ggactggctggaggacgaattattctggctcttgaaggaggtcatgacctgacagccatt
tgtgacgcatctgaagcatgtgtttctgctttgctaggaaatgagcttgatcctattcct
gaaaaaatattacagcagacagcaaatgttaatgcagtgcattccattgagaaggtcatt
gaaatacacagtaagtactggcattcactccaacgttattcttcaacagtcagttattct
ttgatagacgcacagaagtgtgataatgaagaagcggaaactgtaacagctatggcatct
ttgtcagtgggagttaagccacttcctgagaaaaacctggatgaggagcccatggaagaa
gatcctcttctgtag

DBGET integrated database retrieval system