KEGG   Python bivittatus (Burmese python): 103061161Help
Entry
103061161         CDS       T03091                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00052  Galactose metabolism
pbi00500  Starch and sucrose metabolism
pbi01100  Metabolic pathways
pbi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103061161
   00500 Starch and sucrose metabolism
    103061161
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103061161
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103061161
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103061161
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103061161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103061161
NCBI-ProteinID: XP_015746160
LinkDB All DBs
Position
Unknown
AA seq 926 aa AA seqDB search
MKSYQKLTTDVSQITEAGEEGADGKPLCHQKLSAWWLGGGLLMVATLLSGVTVWVLGQIW
WDQHGIPFWSKCTSVPENRRFDCYPERNVIVTRELCEGRGCCFVDSERPLDRMKGVPWCF
YPPDFPSYTLGSMNETDLGMVGFLTRKTKAYYPKDIEKLHLSVEFETDSRLHVKITDATN
PRYEVPLDVPQATKRAENPLYSIEFCKEPFGLIVKRRVSGTVLLNTTVAPLFFADQFLQI
STVLPSTFLYGLGEHESNFLHNLEWNTLPLWARDVPPAESYNLYGVHPFYLLMEKGGAAH
GVFLLNSNLMEVVLQPAPALTWRTIGGILDFYIFLGPDPNLVVRQYQQVIGFPAMPPFWG
LGFHLCRWGYETSNKTWEMVKAMRNFQIPQDAQWNDIDYMNGSRDFTVDSERFASLPQLV
EDLHKHGQYYVLILDPGISSTQPPGSYWPYDEGLKRGVFINNTQGKPLIGNVWPGFTAYP
DFSNPNTHRWWLENLNRLHALVPFDGLWIDMNEPSNFIDGSTEGCSQGELDNPPYVPGIL
GGFLSARTICTSAKQSVSVHYNLHNLYGLMEAKATASALVEIRGKRPFIISRSTFPSQGR
YSGHWLGDNQSEWKDMFWSIPGMLSFSLFGVPLVGADICGFFKSTSEELCIRWMQLGAFY
PFSRNHNSQDEQAQDPTAFSPAGRTAMKEALELRYALLPLLYTLFHRAHLQGDTVARPLF
FEFPKDEATYALDKQFLWGRGLLVTPVLESGADSVTGYFPRGVWYDYYTGSSVNSSGESL
RMAAPLDHINVHLREGTILPTQKPGGSTWLSRRNPLRLIAALSQNANAWGDLYWDDGESL
DTFEKGDYSYLVFNVMQNTFTSTVLHSSVEATYITVEKLSVYGVREEPKTVTVSGKDWPF
TYLTNQVLSVSDLRLPLSQGFYIRWM
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctatcagaaactgaccactgatgtctctcagatcaccgaggctggggaggaa
ggtgccgatggaaaaccgctatgccatcagaagttgtctgcttggtggctaggtgggggc
ctcttgatggtagccaccctccttagtggggtgactgtttgggttcttgggcagatttgg
tgggatcagcatggaattcccttctggtcaaaatgcacctctgtgccagaaaaccgtcgc
tttgactgttaccctgagagaaatgtgattgtgacacgagaactttgtgagggtcggggg
tgctgttttgtggacagtgagaggcccctagatagaatgaagggggttccatggtgcttt
tatccccctgatttccccagctacaccctggggagcatgaatgagactgacctggggatg
gtgggttttctgaccagaaagacaaaggcttactatccaaaagatattgagaagttgcat
ctcagcgtggagttcgaaacagattctcggttgcatgtcaagatcaccgatgccaccaat
cctcggtatgaggtgccccttgatgttcctcaagccacaaagagagcggagaatcctctc
tattccattgagttctgcaaggagccttttggtctgatcgtgaagcgaagagtttcaggg
acagttctgttgaacacaactgtggctcccctgttttttgcagatcagtttctccagatt
tctactgttctaccttcgacgtttctttatgggttgggggaacatgagagtaacttccta
cataatctggagtggaacacgctgcctttgtgggcccgagacgtccctcctgcagagtcc
tacaatctctatggcgtccacccattctatcttctcatggagaaaggtggagctgcgcat
ggggttttcctcctgaacagcaacttgatggaggtggtccttcagcctgctcctgccctc
acatggaggaccattgggggaattttagatttttacatctttttaggaccagaccccaac
ttggtggtccggcaataccagcaggtgattgggtttccagccatgccccccttttgggga
ctgggattccatctctgccgttgggggtatgagacgagcaacaagacgtgggagatggtg
aaagctatgcggaattttcagatccctcaggatgcccagtggaatgacattgattacatg
aacggctcccgggacttcaccgtggactccgagaggttcgccagtctcccccagctggta
gaagatcttcataagcacggacaatactacgtgctgatcctggaccccggaatcagtagc
actcaacctcctggctcttactggccttatgatgaaggtctgaagcgtggcgtattcatc
aacaacacgcaagggaaacctctgataggaaacgtctggcccggcttcactgcttatcct
gacttttctaacccaaacactcatcgttggtggctagaaaacctgaaccgtcttcacgct
ctggttccttttgatggcctttggatcgacatgaatgaaccatccaactttattgatggc
tcaacagaaggatgttcccaaggagagctagataacccaccttatgtgcctgggatcctg
ggaggtttcctttctgcaaggactatttgcacctcggccaagcaaagcgtctctgtgcat
tacaatctccacaacctctatgggctgatggaagcaaaggccactgcaagtgctctggtt
gaaatccgagggaagagacccttcattatttcacgttccactttcccaagccagggcaga
tattcaggacactggctgggtgacaaccagagtgaatggaaggatatgttttggtccatt
ccaggaatgctgagcttcagtctctttggagtcccgttggttggggccgacatctgtggc
ttcttcaaatccacctcagaagaactctgtattcgctggatgcagctgggggctttctat
cccttttcacgaaatcacaacagccaggatgagcaggctcaagatcccacagcctttagc
ccggccggccggactgccatgaaggaggccctggaactccgctatgccctgttgccactt
ctgtatactctcttccatcgggctcatctgcaaggggacactgtagcccgccctctgttt
tttgagttcccgaaggatgaggccacctatgcattagacaagcagtttctttggggccgg
ggcctgctggtgacaccagttctggaatctggcgcagactcagtgactggttacttcccc
agaggtgtttggtacgattactacacgggttcttcagtgaacagcagcggggagagcttg
agaatggcagcacctctagatcacatcaacgtccatctgcgagaggggaccatcctgccc
actcagaaacctggaggcagcacttggctgagtcgccggaaccccctgagactgattgcg
gccttatcccagaatgccaacgcctggggagatctttactgggatgatggcgaaagcctg
gacacctttgaaaagggcgactattcgtacttggtgttcaacgtcatgcaaaacaccttc
acgtccaccgtcctgcattccagtgtggaagccacctacatcacagtggagaaactcagt
gtctacggagtccgggaagagccaaaaactgtcaccgtcagtggcaaagactggccattc
acctatttgaccaatcaggtactcagcgtgagcgacctgcggcttcccctcagccagggg
ttctatattcggtggatgtga

DBGET integrated database retrieval system