KEGG   Python bivittatus (Burmese python): 103061313
Entry
103061313         CDS       T03091                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
pbi  Python bivittatus (Burmese python)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 DUF5663 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 103061313
NCBI-ProteinID: XP_007420728
LinkDB
Position
Unknown
AA seq 372 aa
MNRSADQEMIELKNLGLEEQLDLTRGSRGAAERPVRLERANALRISPGKVPEILTRVRQI
RLLGGQTDPKLTEELGEGHLFRSCTQSQPTWCDLCGEFIWGVYKKRLRCIYCKFICHYRC
RALIRLDCRGPRYKNEQNEGNEQTIEKDTNVDEQVDWEKPILSQAEIEQKIKEYNSQINS
NLFMSLNKDGSYTGFIKVQLKLIRPVSVPANKKAPSIQDTRKSSVRSQAVKRRTSFYLPK
DTIKHLHIISRTRASEVIEALLKKFMVVDNPRKFALFERTEKDDQVYIRKLSDEEQPLRL
RLLAGPSEKTLSFVLKENETGEVNWDAFSMPELQNFLRILQREEEEHTRQILQKYAHCRQ
KMQEALTARTPG
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaaccgttccgcggaccaggagatgattgaactcaagaacctggggctggaggagcag
ctggacctgacccgcggctcgcgaggcgcggccgaacgccccgtccgcttagagcgcgcc
aacgccttgaggatctctcccgggaaagtgcccgagatcttgacccgcgttcgccagatc
cgccttctgggcggccagaccgatcccaagttgaccgaggaactcggcgagggacatctc
ttcagatcctgcactcagagtcaacccacctggtgcgatctgtgcggggagttcatctgg
ggcgtctacaaaaagcgcctccgctgcatctattgcaagttcatctgtcattaccgatgc
cgcgctctaatccgacttgattgcaggggtcccagatataaaaatgagcagaatgaagga
aatgagcagacaatagaaaaagacaccaatgtggatgaacaggttgactgggagaaaccc
attctgtctcaagctgagattgagcaaaagataaaagaatataacagccagatcaacagt
aacctcttcatgagtttgaataaagacggttcctatactggcttcattaaggtacaatta
aagctgatacggcctgtgtcagtacctgccaataagaaagcaccctcaatccaggacact
aggaagagttctgtgcgtagccaggctgtaaagcgccggacttcattctatttacccaag
gatacaatcaagcacctgcatataatttctcgtacacgggccagtgaagtcattgaagcc
ctgctcaagaaattcatggttgttgacaatccccgcaagtttgccctctttgaaagaaca
gaaaaagatgaccaagtatatatccgtaagctttctgatgaggagcaacccctgcgtctc
cggctgcttgctggtcctagtgaaaagacactcagctttgttctaaaggaaaatgagact
ggtgaagtcaactgggatgcctttagcatgcctgaattgcagaactttctgcgtatcctg
cagcgtgaagaagaggagcatactcggcagatcctgcagaaatatgcccattgtcgccaa
aaaatgcaagaggctctgactgctcgcaccccaggttga

DBGET integrated database retrieval system