KEGG   Python bivittatus (Burmese python): 103062872Help
Entry
103062872         CDS       T03091                                 

Gene name
SLC12A8
Definition
(RefSeq) solute carrier family 12 member 8 isoform X1
  KO
K14428  solute carrier family 12 (potassium/chloride transporters), member 8
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pbi02000]
    103062872 (SLC12A8)
Transporters [BR:pbi02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   103062872 (SLC12A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease
Motif
Other DBs
NCBI-GeneID: 103062872
NCBI-ProteinID: XP_007432546
LinkDB All DBs
Position
Unknown
AA seq 748 aa AA seqDB search
MAAPSSVKSRTFLPQVRASMRSDGPVQELFLEEARQGYQTPNKPWWKIQLFVWEPVLFGT
WDGVFTSCMINIFGVVLFLRTGWLVGNTGILMGMFLVSFVILVALVTVLSGIGVCERCSI
GSGGVYSMISTVLGGQVGGTIGLLYIFGQCVAGAMYITGFAESISDLLDLSNIWAVRGIS
LAVLLALLGINLAGVKWIIRLQLLLLFLLAVSTLDFVIGSFTHLDPEYGFIGYSEELMLN
NTLPDYSSGESFFTVFGVFFPAATGVMAGFNMSGDLRKPSTNIPLGSLSAIGISWFLYIV
FVFLLGAICTRESLRYNFMIAEKVSLVGFLFLLGLYISSLASCMGGLYGAPRILQCIAQE
KVIPLLAFLGYGKGPNKTPVAAICLTSLITMAFIFIGQVNVLAPIVTINFMLTYIAVDYS
YFSVSMSYNLKQNAKWMRHEDSRVGLSCSRPLMLSKSTCYGYGSNGIDQCRSDGTLLEFT
KDMNHLFKPVSQDPGINLELKEKNMDAVQMIKQRKQKKAAKQTLQDSFCLALDNNIAHTQ
DPCNDALKSSVKNVRHFSQPNCQEEDEKGASPSAIRKSNQKEEDGDQNFDVMQKASSPQM
EDLNLKQQRQELEIQKIPPSFYSKLCDHRVSFFGAIGSLVIMFVIQWIYTLINLGLAIII
YFYIGQVSPGLPPGAAANFSLFEWMKLLLLNACRGRPSPEERFVVTPTFATVGMETTQLT
EENTDFASRDRYHHSSVITREELVHQFQ
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaccatccagtgtgaaaagcagaacatttttgccccaagtcagggccagcatg
agaagtgatgggcctgtgcaagaactttttcttgaagaggccagacagggttatcagacg
cctaacaaaccttggtggaaaatacagctttttgtttgggaaccagtgctttttggaaca
tgggatggagtctttacttcctgcatgattaacatctttggagtagttctctttttgcgg
acgggttggctggttgggaacactggaattctgatgggcatgtttttggtgtccttcgtc
atcttggtggccttagtaactgtcttgtctggcattggagtttgtgaacgatgtagcatt
ggaagcggaggagtctattcaatgatttctactgtccttggaggtcaagttggagggacc
attggccttctttatatttttggtcagtgtgttgcaggtgctatgtacattactggattt
gctgaatccatctctgacctcctggacctcagtaacatttgggcagtgagaggcatctcc
cttgctgtcctgctggccttgcttggaattaatctggctggggtgaaatggatcatacga
ctccagctgctacttctctttctactggctgtttccacactggattttgtcattggatcc
ttcacacacctcgatccagaatatggttttattggctattcagaggagcttatgttgaac
aacaccctgccagactacagctcaggggagtctttcttcactgtatttggtgtattcttc
ccagctgccacaggtgtgatggctgggttcaatatgagtggtgacctccggaaaccctca
acgaatatccctctaggatctttatctgccattggcatttcgtggtttttgtacattgtt
tttgtttttttactgggagctatttgtacccgagaatcactccgctataattttatgata
gcagaaaaggtgtccttggtgggcttcttattcttacttggtttgtacatttcatcctta
gcatcttgtatgggaggtctctatggagcaccccgaatccttcagtgcattgcccaagag
aaagtgatacctcttcttgcatttcttggatacgggaaaggaccaaacaaaactccagtg
gctgcaatctgcttaacaagcctcatcaccatggctttcattttcattggccaagtgaat
gttcttgccccaatagttacaataaacttcatgcttacatatattgctgtggattattcc
tatttctctgtctccatgagctacaaccttaagcagaacgccaaatggatgcggcacgag
gattccagggtagggctaagttgctctcgacctttaatgctcagcaaatcaacttgttat
ggttatggatcaaatggaatagatcagtgccgatcagatggcactttgctagaattcaca
aaagatatgaatcatctttttaagcctgttagtcaagatccaggaatcaatcttgaacta
aaagaaaagaacatggatgctgttcaaatgatcaagcagagaaagcaaaagaaggcagcc
aagcaaacattacaagacagcttttgtctggctcttgataacaacattgctcatactcag
gatccttgcaatgatgccctaaaatccagtgtcaaaaatgtgcggcatttttcacagcca
aattgccaggaggaggatgaaaagggtgcatctccatctgctattcgaaaaagcaatcag
aaggaagaagatggagaccaaaattttgatgtaatgcagaaagcttccagtccacagatg
gaggatttgaatctaaaacaacaaagacaagaattagaaattcagaaaataccgccttct
ttctattccaagctctgtgatcatcgggtttccttttttggtgcaataggttcattagtc
attatgttcgttattcaatggatctataccctcattaatttgggactagcaattattata
tatttctacattggccaagtgagtccaggactaccacctggtgcagcagctaattttagc
cttttcgaatggatgaaactccttttgcttaatgcctgcaggggaaggccatccccggag
gagcgatttgttgtgacaccgacctttgcaacagttggcatggagaccactcagctcact
gaagagaatacagattttgcttcccgagatcgttaccatcattcctctgttatcacccga
gaagagttggttcatcagttccaatga

DBGET integrated database retrieval system