KEGG   Python bivittatus (Burmese python): 103063043Help
Entry
103063043         CDS       T03091                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00590  Arachidonic acid metabolism
pbi01100  Metabolic pathways
pbi04370  VEGF signaling pathway
pbi04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103063043 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103063043 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103063043 (PTGS2)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103063043 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 103063043
NCBI-ProteinID: XP_007435833
LinkDB All DBs
Position
Unknown
AA seq 570 aa AA seqDB search
MTKGFDQYECDCTRTGFYGENCTTPEFYTWLRLKLKPAPDTVHYILTHFKGIWDIINNIP
FLHNAIMRYILMSRSHLIESPPTYNGRYGYKSWEAYSNLSYYTRTVPPVDHDCPTPMGVK
GKKELPDSKVIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQYFKTDTQKGPAFTKGLGH
GVDLSHIYGETLDRQMKLRLLKDGKLKFQMIGGEMYPPTVKETQAEMIYPPHIPDHLKFS
VGQEVFGLVPGLMMYATLWLREHNRVCDILKGEHPEWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAEFNTLYHWHPLLPDTFQIHNQEYTYPQ
FMYNNSIMLEHGLSHMVQSFSKQRAGRVAGGRNVPAVVQNVAKASIDQTRQMRYRSLNEY
RKYFLLKPFTSFEELTGEKEMAAELEELYGDIEAMELYPALLVEKPRPGAIFGETMIELG
APFSLKGLMGNAICSPEYWKPSTFGGRVGFDIVNTASLQRLICNNVKGCPLTAFHVISSE
TVATNNVSTSSRSIDEINPAVLLKERSAEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggttttgatcaatatgaatgtgactgtacgcggactggcttttatggggaa
aactgcacgacaccggaattttatacttggctcagacttaagctaaagcctgctccagac
acggtacactatatactcacacacttcaaaggcatctgggatataatcaacaacattcca
ttcctccacaatgccataatgagatacattctaatgtccagatcccacttaattgaaagc
ccaccaacatataatggccgctatggttacaaaagctgggaagcctattctaatctttcc
tactatactcgaactgttccaccagtggaccatgactgccccactccaatgggtgtgaaa
ggcaagaaggagcttccagattcaaaagtaattgtagaaaaatttttgctaaggagaaaa
ttcattcctgatcctcaaggcacgaatgtcatgttcaccttctttgcccagcatttcact
caccaatacttcaagacagatactcagaaaggaccagccttcacaaaaggtcttggacat
ggggttgatcttagtcacatctatggagagactttggacaggcagatgaaactaagactt
cttaaggacggaaagctaaaatttcagatgattggtggagaaatgtatccacctactgtg
aaagaaactcaggcagaaatgatctatccaccccacatccctgatcacctgaaattttct
gtaggacaggaagtctttggcttggttccagggctgatgatgtatgccacattgtggctt
cgggaacacaatcgagtctgtgacattcttaagggagaacacccagaatgggatgatgaa
caactatttcagaccaccagactgatcttgataggagaaaccatcaagattgtgattgaa
gactatgtgcaacatttaagcggataccatttcaaactgaagtttgatccagaacttctc
ttcaaccagcaatttcaatatcagaacagaatagcagcagagttcaacaccctttaccat
tggcatcctcttcttcctgatacctttcaaatccataaccaagaatacacttacccacag
ttcatgtataacaattccattatgttagaacatggtctttctcacatggtacagtctttc
tccaagcaaagggctggaagggtagctgggggtaggaatgttcctgctgtagtgcagaat
gtagctaaagcttctattgatcaaacccggcagatgagataccgatccttgaatgaatac
cgaaagtactttctgctgaaaccttttacatcatttgaagaacttactggtgaaaaagaa
atggctgcagaacttgaagagctctatggagatattgaagctatggaactgtaccctgct
cttcttgttgaaaagccacgtcctggagccatctttggtgagaccatgattgaacttggg
gctcccttctccttgaaaggtcttatgggaaatgccatctgctcgcctgaatactggaag
ccaagtacttttgggggtagagtgggctttgacattgtgaatacagcctccctccaaaga
ctcatctgcaataatgtgaagggctgtcccctcacagccttccatgtcatcagctctgaa
acagtggcaacaaataatgtcagcacctccagcaggtcgatagatgaaatcaatcctgcc
gtactactcaaagaacggtcagccgaattgtag

DBGET integrated database retrieval system