KEGG   Python bivittatus (Burmese python): 103063082Help
Entry
103063082         CDS       T03091                                 

Gene name
POMT1
Definition
(RefSeq) protein O-mannosyl-transferase 1
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00514  Other types of O-glycan biosynthesis
pbi00515  Mannose type O-glycan biosynthesis
pbi01100  Metabolic pathways
Module
pbi_M00872  O-glycan biosynthesis, mannose type (core M3)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    103063082 (POMT1)
   00514 Other types of O-glycan biosynthesis
    103063082 (POMT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pbi01003]
    103063082 (POMT1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     103063082 (POMT1)
Glycosyltransferases [BR:pbi01003]
 O-Glycan biosynthesis
  O-linked Man type
   103063082 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMT PMT_4TMC MIR
Motif
Other DBs
NCBI-GeneID: 103063082
NCBI-ProteinID: XP_007422368
LinkDB All DBs
Position
Unknown
AA seq 725 aa AA seqDB search
MLGFLKQPIVFSVEINVNLAVLAVIGLISRLWALSYPRAVVFDEVYYGQFLSLYMKRIFF
VDDSGPPFGHMLFAFGGYLGGFDGNFLWNRIGAEYSSNVPIWALRLLPAVAGGLCVPLAY
QILVELRFTHFVALGAAVLILFENSLITQSRLMLLESILIFFILLAVLSYLKFYNSQKQS
PFSARWWLWLLLTGISCSCAVGVKYMGLFTYVLILSLAGIHCWQLIGDRSLSNISLLWHI
VARGFALLAIPVALYLSFFYIHLLLLYRSGPHDQIMSSAFQASLEGGLSRITQGQPLEVA
YGSQITLRNILGKPLPCWLHSHRNTYPIRYENGRGSSHQQQVTCYPFKDVNNWWIVKDPR
RQQLVASNPPRPVRHGNIVQLVHGITTRYLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRVEIVNRDSDNDIWKTILSEVRLVHVNTSAVLKLSGASLPEWGYRQLEVIGEKISKGY
HQSMLWNVEEHRYGKSHEQKEREVELHLPTQINISQNLTFLAKFTELQWKILTLKNEDTE
HKYSSSPLDWITMDTNIAYWFHSSSGAQIHLLGNVVSWTSANVATVVYVVLFLGYLLRRQ
RNIRDIPEEMWQQWVLAGVICVGGWAVNYLPFFLMEKTLFLYHYLPAITFQILLIPIILQ
HTSDFLCRSKLSKSMHSALVAAWLSSVYLTYHTFRPLTYGEPALPKGELQALRWKDSWDI
LIRKR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcttggattcctaaagcagcccattgtcttctcggtggagatcaatgtaaacctggcg
gttttggctgtgatcggattaataagccggctgtgggcgctgtcctatccgagagctgtg
gtttttgatgaagtttactatggccagttcctctccttgtacatgaagcggatctttttt
gtagatgacagcggcccaccatttggccacatgctttttgcttttggaggttatttgggt
ggatttgatggaaatttcttgtggaacaggataggagcagaatacagctccaacgtgcca
atttgggctttgcggctactaccagcagtagccggtggcttatgtgttcccttggcatac
caaatattggtcgagctacgtttcacccatttcgttgccctgggggctgcagtcctgatt
ttgttcgaaaattcacttattactcagtccagactgatgctgttggagtcaatcttaatt
ttttttatcctgttggcagtattatcttacctgaagttttacaactcgcagaaacaaagt
cctttttctgcaaggtggtggctctggctgttgctaacagggatctcctgttcctgtgca
gttggggtgaaatacatgggcctcttcacttacgtcctcattttgagccttgcgggaatc
cattgctggcaactgattggcgatcgctccttgtccaacatctccctgctgtggcacatc
gtagctcgtggatttgctcttctggccatcccagtcgcgctgtatctctcgtttttctac
atccacttgcttttgctgtaccgttccgggccccacgaccaaatcatgagcagcgctttc
caagccagcttagaggggggtctttctcgcatcactcaggggcagcccttggaagtggct
tatgggtcccagattacgttgaggaatatcttgggcaaacccttaccttgctggcttcat
tcccaccggaatacctaccccatcaggtatgaaaacggacggggcagttcccatcagcaa
caggtgacctgctatccttttaaggatgtgaataactggtggattgtcaaggatcccagg
aggcagcagctggtagctagcaaccctccacggcccgtgcggcacggcaacattgtgcaa
ctggtccacggaattaccacccgttaccttaacacgcacgatgtggctgcgcccctgagc
ccacactcacaagaggtgtcctgttacatcgattacaacatttccatgcccgcgcagaat
ctctggagagtggaaattgtgaaccgcgactcggataacgacatttggaagacaatcctg
tctgaagtcagactggtccacgtcaacacgtcggcagtgttaaagctcagcggagcctct
ctacccgaatgggggtaccgtcaactggaggtcattggcgaaaagatttccaagggctat
caccaaagcatgttgtggaacgtggaagagcaccgatacgggaaaagccatgaacaaaaa
gagagggaggtggaattgcatctgcccactcagatcaacatcagccagaatctcaccttc
cttgccaagttcaccgaactgcagtggaagatactcactctgaaaaacgaggacacggaa
cataaatacagttcgtcccctttggattggatcaccatggacaccaacattgcttactgg
ttccattccagctcaggggctcagattcatctcttgggcaatgtcgtcagctggacgtcg
gccaacgtggccacggtcgtctacgtggttttgttcctggggtacctcctgcggcgacag
cggaacatccgggatatccctgaagagatgtggcagcagtgggtcctggccggagtgatt
tgcgtgggtggatgggctgtgaactatctccctttcttcctgatggagaagacgcttttc
ctttatcattatctgccggctattacttttcaaatcctcctgatccccatcatcctgcag
cacacgagcgacttcctctgcaggtccaaactttccaagagcatgcacagtgctctagtc
gcagcctggctgtcttccgtctaccttacataccacacgttccgtccgctcacctatggt
gagccggcactccccaaaggcgagttgcaggccctgcgctggaaggacagctgggacatt
ttgatccgcaaacgctga

DBGET integrated database retrieval system