KEGG   Python bivittatus (Burmese python): 103064242
Entry
103064242         CDS       T03091                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103064242 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pbi04052]
    103064242 (EPO)
Cytokines and growth factors [BR:pbi04052]
 Cytokines
  CSF and other factors
   103064242 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 103064242
NCBI-ProteinID: XP_007440309
LinkDB
Position
Unknown
AA seq 178 aa
MGKPGLILFLLVWGFLDPALPAPARPVCDQSVMNKFIQDASKMENEIVALCEDSCNLPEH
VTVMDTRVNFPDWRAMNRSRQASEVWWGQALLSVAVGQVKTQQPRMRPFLRQLEVMESGL
RSIREILRRHNAQADPQDETSTRTLSVQTVKKLFSVYSSFLRGRVNLFIASACQGNGR
NT seq 537 nt   +upstreamnt  +downstreamnt
atggggaaacctgggctgatccttttcctgttagtgtggggattcttggacccagccctg
cctgcccccgcccggcccgtgtgtgaccaaagcgtcatgaacaagttcatccaggacgcc
agcaagatggaaaatgaaatcgtggcactttgtgaagattcctgcaacttgccggaacac
gtgacagtgatggacacgagggtgaattttcccgattggagagcaatgaatagatccagg
caggcctcggaagtgtggtggggccaggcccttctttccgtggccgtcggccaagtcaag
acccagcagccgaggatgcggcccttcctgcgccagctggaggtgatggagagtggcctg
cgaagcatccgggagatcctgcgcaggcacaacgcccaggcagatccccaggatgagaca
tccacccggactttgagtgtgcaaactgtcaaaaaactgttcagcgtgtactcgagtttc
ctccgtggcagggtcaatttattcattgccagtgcgtgccaggggaacggcaggtga

DBGET integrated database retrieval system