KEGG   Python bivittatus (Burmese python): 103065078Help
Entry
103065078         CDS       T03091                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00240  Pyrimidine metabolism
pbi00983  Drug metabolism - other enzymes
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    103065078 (TK1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103065078 (TK1)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     103065078 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 103065078
NCBI-ProteinID: XP_007428568
LinkDB All DBs
Position
Unknown
AA seq 233 aa AA seqDB search
MNCLMIPGARPESPHKARGQIQVIFGPMFSGKSTELMRRVRRFQIAQYKCLLVKYAKDTR
YCINGVSTHDRYTMEAMSACYLKDVQQEALTSTVIGIDEGQFFPDIVEFCETMANAGKTV
IVAALDGTFQRKAFGNILQLVPLAESVVKLNAVCMECYHEASYTKRLGTEKEVEVIGGAD
KYHSVCRVCYFKNQQQLVSENKENLPGGNKQLDINVSRKVLATHQITQWSPSN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcctgatgataccgggtgcgcgaccagaatccccgcacaaggcccgcggccag
atacaggtcatatttggacccatgttttctggaaaaagcactgaactaatgcgccgagtc
cgtcgatttcaaattgcacagtataaatgtctactagtcaagtatgctaaagacacacgc
tattgcatcaatggagtctccacacatgacagatacaccatggaggccatgtcagcttgt
tacctcaaagatgtacagcaggaggctctcacttccactgtgattggcattgatgaaggc
cagttttttccagatatagttgaattttgtgagacaatggccaatgcagggaagactgtc
attgtggcagcacttgatggaacgtttcagcggaaggcttttgggaacatcttacagcta
gtccccttagcagagagtgtggtgaaactaaacgctgtttgtatggagtgttatcatgaa
gcctcttatacaaaaaggctggggacagagaaagaggtggaagtaataggaggggcagac
aaatatcactcagtctgccgggtctgctatttcaagaaccaacaacagttggtatctgaa
aacaaagagaacctaccaggtgggaataaacagctggatattaatgtctccagaaaagtc
ttggctacccatcagatcacgcaatggagtccatctaattga

DBGET integrated database retrieval system