KEGG   Python bivittatus (Burmese python): 103065099Help
Entry
103065099         CDS       T03091                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00052  Galactose metabolism
pbi00500  Starch and sucrose metabolism
pbi01100  Metabolic pathways
pbi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103065099 (GAA)
   00500 Starch and sucrose metabolism
    103065099 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103065099 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbi04147]
    103065099 (GAA)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103065099 (GAA)
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103065099 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 103065099
NCBI-ProteinID: XP_007434789
LinkDB All DBs
Position
Unknown
AA seq 909 aa AA seqDB search
MLVTSALAFVITVLGISGILEAAIAASKTENDHRGKNHGRESEILEEQLEPLLPPMQCNI
PADSRFDCAPEKLLSQDECQARGCCYVPVSSKGSAGWQPWCFFPTSYSSYKMANVTATQT
GYTAHLTRSSPSFMPDDIMNLQLDVIFETEGRLHFTLKDPAKKRYEVPLETPKTTSKESS
TLYSVQFSADPFGLIVLRKSNGQVLLNTTVAPLFYADQFLQISTALPSCFISGLGEHLTP
LTLNVNWTKITLWNRDISPAPSANLYGSHPFYVALEKGGLAHGVFLLNSNAMDVLLQPHP
ALTWRTTGGILDFYIFLGPDPKSVVHQYMDVVGYPFMPPYWALGFHLCRWGYTSTAVTRE
VVKNMTAALFPLDVQWNDLDYMDAKRDFTFNKDGFWDMSDMVNDFHHGGRRYVMIVDPGI
SSSSPPGSYRPYDEGLKRGVFIINATGQPLIGRVWPGPTAFPDFTNPETHQWWYDMVKDF
HDQVPFDGMWIDMNEPSNFVDGSLEDCPNNKLENPPYVPGVLGGSLKAKTLCASSRQYLS
SHYNLHSLYGLTETIATHDALVKVRGKRPFVISRSTFASHGHYAGHWTGDVASVWEDLYY
SIPAMLLFNLYGVPLVGADVCGFLKNTTEELCVRWTQLGAFYPFMRNHNGHGSKAQEPYA
FSQEAQQAMRKAFYLRYSLLPYLYTLFHKAHSTGETVARPLYFEFPQDTYTWNIDRQFMW
GAGLLITPVLEEGIRKVTGYFPLGTWYDTITGSVIHSKGQWILLPAPLDTINVHIRGGHI
LPLQEPALTTTESRLNGMTLMVALTLEGVARGNLFWDDGEGLLTFEKGDYTQIFFLASNG
VLVNELVQLSSHIDGLLLVEVLVLGVSSPPQRVLANGTPVLDFSYRTDTKVLSIPLSLLM
GEEFVITWS
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgacttcagctctagcatttgtaatcaccgtgcttggtatatctggaatcttg
gaagcagccatagctgcttctaaaacagagaatgatcaccggggtaagaatcatggcagg
gaatctgagatactggaagaacagttggaacccctcttgccgcctatgcagtgcaacatc
cctgcagacagccgctttgactgtgccccagagaaacttctctctcaagatgaatgtcaa
gctcggggatgttgttatgtcccagtttcttccaaaggctctgctggttggcagccatgg
tgcttctttcctaccagctactctagttacaagatggcaaacgtaactgccacccagact
ggctatactgcccacctgacccgcagttcaccctctttcatgccagatgacatcatgaat
ttgcagctggatgtgatttttgagaccgaggggaggcttcacttcacacttaaggatcca
gctaagaaacgctatgaagtccctttagaaactcccaagacaaccagtaaggaatcctca
actctctattctgtgcagttctctgctgatccctttggcctcattgttcttcggaagtcc
aatgggcaagtgctgcttaatactactgtggctcctctgttctatgctgaccagttcctt
cagatctccactgctttgccatcatgtttcatctctggattgggtgaacatctgacccct
cttactctgaatgtcaattggaccaaaattaccctgtggaatcgggacatatcacctgcg
ccctctgccaacttatatggttcacaccccttctatgtggctttagaaaagggtggcttg
gcccatggagtcttcttactgaacagcaacgctatggatgtgctactacaaccccaccca
gcattgacatggagaactactgggggtatcttggatttctatattttcttgggcccagac
cctaagagtgtggtgcaccaatacatggatgttgttggctacccgttcatgcctccttat
tgggctcttgggttccatctttgccgctggggatacacgtccactgctgttacacgggag
gtggtgaaaaacatgactgcagcactttttcctctcgatgtgcagtggaatgatctggat
tatatggatgctaagcgagattttaccttcaacaaggatggtttctgggacatgtcagac
atggtgaatgatttccatcatggcggccggagatatgtcatgattgtggatccagggatc
agcagctccagtcccccaggcagttataggccctatgatgaaggcctgaagcggggggtt
ttcatcataaatgcaacaggacaacctttgattggaagggtttggcctgggcccactgcc
ttccctgatttcaccaacccagagactcaccagtggtggtatgacatggtcaaggatttc
catgaccaagtgccctttgacggcatgtggatagacatgaatgagccatcaaattttgtg
gatggttccttggaagactgtccaaacaacaagcttgagaaccccccttatgtaccaggt
gtgctgggtggatctttgaaggcaaaaaccctctgtgcctccagtaggcaatacctgtct
tcccactataacttgcacagcctttatgggttgactgagactattgcaacacatgatgct
ttggtgaaagtgcgagggaagcgtccatttgtgatctcacgttccacctttgccagccat
ggacactatgctggccattggactggggatgttgcaagcgtttgggaggatttatactac
agtataccagcaatgttgctcttcaatctctatggggtgccattggttggggctgacgtc
tgtggatttctgaaaaacacgacagaagagctgtgtgtgcgctggacccagctgggcgca
ttctaccctttcatgcgaaaccacaatggccatggaagcaaggctcaggagccatatgcc
ttcagccaggaagcccagcaagccatgagaaaagccttttacctgcgctactccctgctg
ccctatctttacaccctgttccacaaggcccactccacaggcgagacagtagcccgtccc
ctttattttgaattcccacaagacacttatacgtggaacattgatcgacagttcatgtgg
ggagctgggctcctcattactcctgtgttagaagaagggataagaaaagtgactggctac
tttcctttagggacatggtatgacaccataacgggatccgtcatccacagcaagggtcag
tggattctcctaccagctccacttgacacaatcaatgtccatatccgtggaggtcacatt
cttcctttgcaggagcctgctctcacaaccacagagtcccgcttaaatggaatgactctc
atggtggctttgaccctggaaggggtagccagagggaatttgttctgggatgatggtgaa
gggctgctgacctttgagaagggcgattacacgcagatcttctttctggcaagcaacggt
gtgctggttaatgagcttgtgcaactcagcagccacatagacgggcttctgctggtagag
gtgctggtgttaggtgtctccagccctccgcagcgggtcctggcaaatggcacccctgtc
ctggacttttcttaccgcactgataccaaggtccttagtatcccactctctttgctgatg
ggggaggaatttgtcataacttggtcctga

DBGET integrated database retrieval system