KEGG   Python bivittatus (Burmese python): 103065815Help
Entry
103065815         CDS       T03091                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00052  Galactose metabolism
pbi00500  Starch and sucrose metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103065815
   00500 Starch and sucrose metabolism
    103065815
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103065815
    3.2.1.20  alpha-glucosidase
     103065815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103065815
NCBI-ProteinID: XP_015744265
LinkDB All DBs
Position
Unknown
AA seq 1810 aa AA seqDB search
MGKKKFTGLEISLITFFLLLLIVTCTLIALLATGYSGLKAFSPTCPVIPLPERIDCIPDQ
VATKDLCVLRGCCWDPQNETQVPWCYFSKDHGYQVQGSVSETNSGFEATLIRLPSPSLFG
SDIEKVLLTAEYQTGNRFRFKITDPANKDRYEVPHENVQPFKGSKASNLMYQIEVTENPF
GISVIRNSNNKVLFNTSIGPLIYADQFLQLSIRVPSWNVYGVGEHVHRQYRHDFNWKTWP
IFTRDAFPNGDMSNLYGAQTFFLCLEDNSGHSFGVFFMNSNAMDFALQPAPAITYRTIGG
ILDFYIFLGNNPEQVVQEYLSLIGLPWMPSYWNLGFHICRWNYTDLNDVKAVVERNRAAG
IPYDVQYTDIDYMEDTKDFTYDKKNFAGLPEFVQDLHNHGQKYVIILDPAISVNNLTNST
PYEAYLHGEQMKVWINESDGISPLIGEVWPGTTVFPDFSNPEAVQWWVNECSNFHKTIHF
DGLWIDMNEVSNFIKGSKTGCAANSLNYPPFTPKILDGVMYSKTLCMDAIQKAGKHYDVH
SLYGYFMSIATDKALQTIFHEKRSFLLSRSTFSGSGKFTGHWLGDNFATWNDIKWSIPGI
LEFGLFGYPFIGADICGFLENVSEELCRRWLQLGAFYPFSRNHNAASFAPKDPAYFGQNS
LLVNSTKHYLTIRYTLLPYLYTLFYKAHAWGETVARPILHEFYSDEATWAIDRQFLWGPG
LLITPVLDPGVDTVTAYIPDAVWYEYETGLKAPWRKQECQMFLPANKLGLHLRGGYIFPI
QQPANTTVYSRSKPMGLIIALDENEEAAGDLFWDDGITKDTVANEKYLLCHFSVTNNVLT
IAVTRKGYTDPNNLIFENIKILGLPLEPSDVKVTSNNVAQTYNLNVSYSAANKVAYITGL
QLKLGEEHTISWKQSLRDIDRFDCHPEQNPSKAKCEALGCIWNTSAVHGAPYCYYPPDNG
YAVDQIEYTSSGLTANLHSNHGSVRLSGLQVPLIDRLHLEVKYHENNMLQFKIYDSSKKR
FEVPVPLNLPQTPASTLENRLYEVSIQNRPFGIQVRRKSTGTVIWDSQVPGFTFSDMFIQ
ISTRLPSQFVYGFGETEHKQFQHEMNWKTWPMFARDQSPGYQFNTYGVHPFYMGLEDDGN
AHGVLLLNSNGMEVKFQPTPALTYRTIGGILDFYMVLGPTPEQVVQEYTALIGRPVLPPY
WGLGFQLCRYGYQDDAEISELYDKMKAANISYDVQYADIDYMERQLDFTLSPSFAKLPAV
IDRLKRDGMRFVIILDPAISGNETDYPAFIRGVQKDVFIKWPNSSDTVWGKVWPYLPHVV
INSSFGWDDKVKFYSAWTAFPDFFRKSTAQWWKKEIQEVYNNPTNQSQSIKFDGLWIDMN
EPANFVNGAVTGCGSSELNNPIYMPDVLGKNVGLNEKTLCMESEQILPDGSPVRHYDVHN
LYGWSQTKPTYDALHSITGERGIVISRSTYPSSGKWAGHWLGDNFSKWDQLYKSIIGMME
FSLFGISYTGADICGFNENTTYELCARWMQLGAFYPYSRNHNGIGFVSQDPVAFDKKFEE
ISRNVLSTRYTLLPYLYTLMYEAHAHGNTVVRPLLHEFTDDKETWSIQEQFLWGPALLIS
PALYENTTEVEAYFPDACWYDYYKDENIGTRRQLRKLPTPLDHINLHLRGGYIIPWQLPA
LNTKASRKNLMGLTVALDDNGAAQGLLYWDDGTKIDAYEKGLYLLHTFNVSQNVLDIRIT
HQGYFDPNNLKFGEVKILGIQLNTPPSVVIFQNDASIPATHKVTYNSSSKVMHITDLHLF
LGQAYSLRWN
NT seq 5433 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaaaaattcactggattagaaatctccctgatcactttcttccttttgctg
ctcattgtaacttgcaccttgattgcacttctagcaacaggttattctggtcttaaagcc
ttttcacctacttgtccagtaatccctcttcctgaaagaatagattgcatcccagatcaa
gttgcgacaaaggatctatgtgtactccggggctgttgctgggatcctcagaatgaaaca
caggtaccttggtgctacttttctaaagatcatgggtaccaagttcaaggaagtgtgtca
gaaacaaattcaggatttgaagctactctaataagactgccttctccctccctgtttgga
agtgatattgaaaaggttctcctcactgcagaataccaaacaggaaaccgatttcgtttt
aagattacggatcctgccaataaagatagatatgaagtcccacatgagaatgttcaacct
tttaagggatctaaagcaagtaatttaatgtaccagatagaagtcacagaaaatcctttt
ggaatcagtgtgatcaggaatagcaataataaagtcctcttcaacaccagcataggacct
cttatatatgccgaccagttcttgcagctttccattcgagtgcctagttggaatgtttat
ggcgtgggcgaacacgttcatcgacagtaccggcatgattttaactggaaaacatggcct
atctttacccgggatgcttttcccaatggggatatgagcaacttgtatggtgctcagact
ttcttcttatgcctggaagataacagtggacattcctttggggtgttctttatgaacagt
aatgccatggattttgctcttcaacctgctcctgctataacatacagaacaattggtgga
attttagatttctatatcttcttgggaaataatccagagcaagtagtccaagaatatcta
tcgctgataggacttccatggatgccttcctattggaatcttggcttccacatctgtcga
tggaattacactgatcttaatgatgtgaaagctgtagtagaaaggaatcgagcagctgga
ataccttatgatgttcaatatactgatattgattacatggaagataccaaagattttact
tatgacaagaaaaactttgcaggcctccctgaatttgttcaagaccttcataaccatgga
cagaaatatgtcataatactggatccagccatttctgtcaataatctcaccaacagcaca
ccttatgaagcttatctacatggtgaacaaatgaaagtgtggataaatgaatcagacgga
ataagccctcttattggagaagtgtggccaggaacaactgtcttccctgatttttccaat
cctgaagctgttcagtggtgggttaatgagtgcagcaattttcacaaaacaatccatttt
gatggactgtggattgacatgaatgaggtatccaattttatcaaaggatcaaaaactggc
tgtgcagcaaacagtttaaactacccaccttttactccaaagattcttgatggagttatg
tattcaaagacactttgcatggatgcaatccaaaaggcagggaaacactatgatgttcac
agcctctatggatatttcatgtctatagctactgataaagcactccagactattttccat
gaaaaaagaagtttcctcctttcccgatcaacattttctggttctggaaaattcacagga
cattggctgggagataattttgcaacttggaatgatattaaatggtctataccaggaata
ttagaatttggtctctttggatatccttttattggagcagatatctgtgggttccttgaa
aatgtctcagaagaactttgtagacgatggttgcaacttggagcattttaccccttttct
aggaatcacaatgctgcatcatttgcccctaaagatccagcatattttggacaaaattca
cttttggtgaactcaaccaaacactacctgacaatacgttacactttgttgccgtatctc
tataccctgttttacaaagcgcatgcttggggagagacagttgcaaggcccattctacat
gaattctactctgatgaagccacctgggctatagacagacaattcttgtggggacctgga
ctacttattactccagtcttagacccgggtgttgatacagtaactgcatacatccctgat
gctgtgtggtatgaatatgagacaggtctaaaagcaccgtggagaaaacaagagtgtcaa
atgttccttccagcaaacaaacttggacttcatctcagaggaggttacatcttccctatt
cagcaaccagccaacacaactgtatacagccgttcaaagcctatgggacttataattgct
ttagatgagaatgaagaagcagctggagacttattctgggatgatggaataaccaaagat
acagtggcaaatgaaaagtacctcttatgtcactttagtgtcaccaataatgtcctaact
atagctgtgacacgcaaaggctacacagatccaaataatttgatatttgagaacatcaaa
atccttgggttaccccttgagccttcagacgtgaaagtgacctcaaataatgtggctcaa
acatataatctgaacgtcagttacagtgctgccaacaaggttgcctacataactggtctg
caacttaaactaggggaagaacatacaatctcctggaagcagtctttaagagatattgac
agatttgattgtcatcctgaacaaaatccatcaaaagcaaaatgtgaagctcttggctgc
atatggaatacttctgctgttcatggagctccatactgctactaccctcctgacaatggt
tatgcagttgaccaaattgaatacacatcatctggtttaacagcaaatcttcatagtaac
catggctctgttagactttcgggactgcaagtccccctcattgacagacttcatttggaa
gtgaaatatcatgagaacaatatgcttcaatttaagatttatgattctagtaaaaagaga
tttgaagttccagtgcctctgaatcttccccaaacccctgcaagtactctggaaaaccgt
ctctatgaagtatcaattcagaacaggccatttggaatccaagttcggcgcaaaagcact
gggacagtcatttgggattcccaggtacctggtttcaccttcagtgatatgttcattcag
atttcaactcgcctaccttcacagtttgtatatgggtttggggaaacagagcataaacaa
ttccagcatgaaatgaattggaaaacctggccaatgtttgcaagggatcagtctcctgga
tatcaatttaacacttatggagttcaccctttttatatgggtttggaagatgatggtaat
gctcatggagtcttgctgctgaacagtaatggaatggaggtaaaattccagccaactcct
gctttaacataccgtaccattggaggaattttggacttctacatggttttgggcccaact
ccagaacaagtggttcaagaatacactgcactcattggacgtccagtcttgcctccatat
tggggtttgggattccagttgtgtcgatatggatatcaagatgatgcagaaatatctgaa
ctgtacgataaaatgaaggcagctaatatctcctatgatgtacaatatgctgatattgac
tacatggaacggcagctggatttcactctaagtcccagttttgcaaaacttccagctgtg
attgacagactaaaaagggatggaatgaggtttgtcatcattttggatccagccatttca
ggaaatgaaactgattatccagccttcataagaggagttcagaaagatgttttcattaaa
tggcctaatagcagtgatactgtgtgggggaaggtatggccatatcttcctcatgttgtg
ataaattcatcattcggttgggatgacaaagtgaaattttacagtgcttggactgctttc
ccagattttttccgcaaatctacagctcagtggtggaaaaaagaaattcaagaagtctac
aataaccccaccaatcaatcacaaagcattaagtttgatggcctatggattgatatgaat
gaacctgcaaattttgtcaatggagcagttactggttgtgggagctctgaactaaataat
cctatatatatgccagatgtactggggaaaaatgtgggactgaatgagaaaactttgtgt
atggaaagtgaacagattctgcccgatggaagcccagttcgacattatgatgtccacaat
ctatatggttggtcacaaactaagcctacctatgatgctctacatagtatcactggggaa
cgtggcattgtcatttctcgttcaacttatccctcgagtggcaaatgggcagggcattgg
ctaggggataacttttcaaaatgggaccaactttacaaatccataattggtatgatggaa
tttagcctttttggaatatcctatactggagcagatatctgtggcttcaatgaaaataca
acttatgaattgtgtgcccgttggatgcaactgggtgccttttatccatattccagaaat
cataatggcattggatttgtgagtcaagatcctgtagcctttgataagaaatttgaagaa
atatccaggaatgtgctcagtaccagatatactttgcttccatatctgtacacactgatg
tatgaagcccatgcccatggaaacacagttgtgcgccctttacttcacgaatttacagat
gataaagaaacatggagtatacaggagcagtttctctggggacctgcattactcattagc
cctgcactatatgaaaacactacagaagtggaagcttactttccagatgcctgctggtat
gattattataaagatgaaaacattggcacaaggcgacagctcagaaaattaccaactcct
cttgatcatatcaaccttcatctcagaggtggctatataatcccatggcagctgcctgct
ttaaacaccaaggccagtcgaaaaaatttaatgggacttacagttgctttggatgataat
ggggctgctcaaggacttctttattgggatgatggaacaaaaattgatgcatatgagaaa
ggactttacctcttacacacatttaatgtcagtcagaatgtcttggatatcaggatcacc
catcaaggatattttgacccaaacaacttaaagtttggtgaagttaaaatcttagggata
cagctcaacacccctccaagtgtggttatatttcagaatgatgcaagtattccagctact
cacaaagtaacatataattcttcaagtaaggtaatgcatattacagaccttcaccttttc
ctgggacaagcatattcactgcgatggaactag

DBGET integrated database retrieval system