KEGG   Python bivittatus (Burmese python): 103066049Help
Entry
103066049         CDS       T03091                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04210  Apoptosis
pbi04625  C-type lectin receptor signaling pathway
pbi04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103066049 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103066049 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103066049 (MAP3K14)
   04672 Intestinal immune network for IgA production
    103066049 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103066049 (MAP3K14)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103066049 (MAP3K14)
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: STE group
  Other
   103066049 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr FTA2 APH Kdo
Motif
Other DBs
NCBI-GeneID: 103066049
NCBI-ProteinID: XP_007430203
LinkDB All DBs
Position
Unknown
AA seq 938 aa AA seqDB search
MAVMEIACQDDTEPATGSPKDLLMGKGPEEVATEKKSSVCKVEEPDKKMFHGPWKILNDV
IAKGTAKEDSGEGSLASISIIAQAECEISQEFSPTYSERPFIADTKRYGRSCSLDQIPNN
VAHATEGKMAPVHWKALHRGKSRKKRRKRKSSLETPERVATLIRKPRTPEQESCVPIPVQ
EDDSHLGTLFNITSWHSELCKDLSSDFSSFEKPSQVLSASKLHMLKNQAKLELHKLISPA
QCLSHVWKSYTQDNFGSQSETVHPSPSSKFPPYLYGCGYLLPALNLGPLKTYLFDDLSNV
DGECHLSDLNLAHSFSKCSHQSAKNTSDTLSMDEFLVDALKGNVILGEPRNLACLAKTWK
GDGSSSKACLQEINENEGVLLTEKLKAVDYEYREEVHWTKCQGLLGTGSFGEVYKMEDKQ
TGFQCAAKKVQVEHFRAEELTTCAGVTHAKVLPLYGAVKEGLWVTIFMKLMEGGSLGQLL
KQCGYLPEDRALDYLSQTLEALEYLHAHNVLHGDVKADNVLLSGDRSHAVLCDFGHAAQL
HPDGIRNCLTTGDYVPGTETHLAPEIVMGKHCDFKVDVWSSCCMMLHLLNGYHPWTQYYN
HPLCLKIAKEPPPLREIPPSCHPSTVQVITSGLEKEPTKRASAAELRMKTCKALKQVGGL
KSSWSGEYREPRCLQLTQKTSLPELLLPIPEPPGSPKLLSRSPSPPLPCQDLTARKQLIH
PDMCKELLLSCDSLLPSFLTPPSTRKGSMTEWRTPSIDHDLQQLEFDLILNSLSQPFSLE
EQEQMLSCFSLDSFLPSDASEKSSLKLSHSLKDTMSSGVHSWNSQADGQSTSWNSWLHRS
RNTDMPTYVNGVKIEICLLSGESLHIREFRGAKVGDVATGISSQIPAPAFSFFTKEGDPV
RCDMEIPDSGIELQCTLAPDCSSGWKWRVKHGQLEKRL
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaatggaaatagcttgccaggacgatacagaaccagccactggatctccaaag
gatcttctaatgggcaaagggccagaagaggtagcgactgaaaagaaaagcagcgtttgc
aaagtagaggaaccagataaaaagatgttccatggaccgtggaagatcctgaatgatgtg
attgctaaaggaactgccaaggaagacagcggagaagggagcttagcctcaatctccatc
attgcccaggcagaatgtgagataagccaggagttcagtccaacctattcagagaggcct
tttattgctgacacaaaacgatatggccggtcttgcagccttgatcaaatccccaataat
gtggctcatgcaactgaaggaaaaatggctccagtccactggaaagccttgcatcgtggc
aaatcccggaagaaacggcgaaagagaaagtcctcccttgaaacaccagaaagagtggcc
accctaattcgaaagccaaggactccagagcaggagagctgtgtacctatacctgtgcag
gaagatgactctcatttgggcaccctcttcaatatcacttcatggcattcagaattgtgt
aaggatttgagttctgatttcagttcctttgagaaacccagccaagttttatctgctagc
aagttgcacatgttaaagaaccaagcaaagctagagttacacaagctgatcagccctgct
cagtgcttgagtcatgtttggaaatcctatactcaggacaattttggctctcaatcagag
actgtgcatccctctccttcaagcaaatttcctccttatttgtacggctgtggctatttg
cttcctgctttgaatcttggccctctgaagacttatctttttgatgatctttcaaatgta
gatggtgaatgtcacctttcagacttgaatctggcacatagcttttccaaatgtagtcat
cagtctgcaaaaaacacttcagacactctttcaatggatgaatttctggtggatgcattg
aagggaaatgttattcttggagaaccaagaaacttagcttgtttagccaagacttggaaa
ggagatggatcaagttcaaaagcgtgccttcaggagattaatgaaaatgaaggagtgtta
cttacagagaaactcaaagcagtcgattatgagtaccgcgaagaggttcactggaccaaa
tgtcagggtttgctgggcacgggctctttcggagaagtgtacaaaatggaggacaagcag
accggctttcagtgtgcagccaaaaaggtgcaagtcgaacacttccgtgcagaagagctg
acaacatgtgctggagtgacacatgctaaagtcctcccgctatatggagcagtgaaagaa
ggcctgtgggttactatctttatgaagctgatggaaggtggatcactgggccagctactt
aagcagtgtggatacctacctgaggacagagctcttgattatctcagccaaacgctggag
gccttggaataccttcatgcccacaatgttctgcatggagacgtaaaagctgacaatgtc
cttttatctggtgatagaagccatgctgttctctgtgattttggtcatgcagctcaactt
catccagatggcataaggaactgtttaacgacaggggattatgttcctggcactgagacc
cacctggctcctgaaatagtaatggggaagcactgtgatttcaaggtagacgtctggagc
agttgctgtatgatgctgcatctactgaatggttatcacccttggacccagtactataat
catcctctgtgcctcaaaatagccaaagaaccaccccccctgagagaaatccccccctcc
tgtcacccatccactgttcaggtcattacatctgggcttgagaaagagcctacgaaacgg
gcctctgcagcagagctaaggatgaaaacctgcaaagcacttaagcaagtgggaggcctg
aagagttcctggagtggtgaatacagagaacccagatgcctgcagttgacgcagaaaact
agtctcccagaattactgttgcccatacctgagcccccgggtagcccaaagctgttgtct
agaagccctagccctccattgccatgtcaggatctgactgcaagaaaacagttaattcac
ccagacatgtgcaaggaattactgctatcatgtgactctcttctaccctccttcctgact
cctcccagcactaggaaaggcagtatgacagaatggaggacccccagcattgaccacgac
cttcagcagctggagtttgatctaattctgaacagcctgtcacagcccttttcactggag
gaacaggaacaaatgctgtcatgcttcagcttggatagcttcctcccatcagatgctagt
gagaagagctcattgaagttgtcccacagtctgaaggacaccatgagttctggtgtgcac
tcctggaacagccaagcagatgggcagagcaccagctggaacagctggctgcatcgtagc
aggaacacagatatgcccacttacgttaacggggtgaaaattgagatttgcttgcttagt
ggggaaagcctccacatcagagaattccgtggggccaaggtgggagatgtggccactgga
atcagcagccagataccagcccctgcattcagcttcttcacaaaagaaggtgatcctgtt
cgttgtgatatggagatccctgattcaggcattgagcttcagtgcactttggcgcctgat
tgcagttctggctggaagtggagagtcaaacatggtcagttagagaagaggctataa

DBGET integrated database retrieval system