KEGG   Python bivittatus (Burmese python): 103066252Help
Entry
103066252         CDS       T03091                                 

Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04217  Necroptosis
pbi04621  NOD-like receptor signaling pathway
pbi04623  Cytosolic DNA-sensing pathway
pbi04625  C-type lectin receptor signaling pathway
pbi05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103066252
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103066252
   04623 Cytosolic DNA-sensing pathway
    103066252
   04625 C-type lectin receptor signaling pathway
    103066252
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103066252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PYRIN CARD zf-ZPR1
Motif
Other DBs
NCBI-GeneID: 103066252
NCBI-ProteinID: XP_007440902
LinkDB All DBs
Position
Unknown
AA seq 202 aa AA seqDB search
MAKNVRCYLREALEDLTEDELRKFKANLNEFQVRPGYNNVPKGRLQKADALDLSDLLISY
YGEDYALEVTAAVLSDSNCKPQARKLLKATEKGACSFVQSPMPHFSTHSRKAEVQPSEVH
FIERHREALIQRTATVEGILDRLHGVVLNDEQYQKIITKRTNQDKMRELYKLLPSWNRYC
KDLLYEVLKEKNKFLIDDLEGQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaatgtccgctgctacctccgagaagccttggaggacttgacggaggacgag
ctccgaaagttcaaggcgaacctcaacgaattccaggtcaggccgggctacaacaatgtc
cccaaagggcggctgcagaaggcggacgcgttggatctgagcgacctcctgatcagttac
tacggcgaggattacgccctggaggtgacggccgccgtgctgtcagacagcaactgcaag
ccgcaagcgcggaagcttctcaaagccactgagaaaggtgcttgcagttttgttcagagt
cccatgccccatttcagcacccactcaagaaaagctgaggtgcagccctcagaagtgcat
tttattgaacgccatcgggaggcactcattcagagaacagccacagtggaaggaattctg
gatcggctgcatggagttgtcctgaatgatgagcaatatcaaaaaatcatcacaaagaga
acaaaccaggataaaatgagggagctgtacaagctgctgcctagctggaatcgttattgc
aaggatttgctctatgaagttctgaaggagaaaaacaagttcctcattgatgaccttgag
ggacagtga

DBGET integrated database retrieval system