KEGG   Python bivittatus (Burmese python): 103066598Help
Entry
103066598         CDS       T03091                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00052  Galactose metabolism
pbi00500  Starch and sucrose metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103066598 (GANC)
   00500 Starch and sucrose metabolism
    103066598 (GANC)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103066598 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 103066598
NCBI-ProteinID: XP_007428666
LinkDB All DBs
Position
Unknown
AA seq 915 aa AA seqDB search
MESSSQEISVQDEAVDKSQFKTCKQIAFYRRQKHLCPGKSPYQTLLKTVELSNSNLKFQI
INEESKVPLAVEIYEIEGNIFRLKINEVNPLKPRYEVPDVLIKEPASLRLKISEKDADKL
VLTGPEQEQQIHIMAKPFQIQLISKDEILLSMNSSGLLYLEHLQSPPQNRKSTSQEKESG
LADSSKENEEDLGLWEEKISSFLDIKANGPSSVGLDVSLHGFEHVYGIPQHAETLLLKNT
SDDDVYRLYNVDVFGYTIHSKMGIYGSVPLLLAHKPDQTIGVFWLNSSETLVEISTKAAV
KVLPSKTPDISKQRVVPQTDVRWMSESGIIDVFILKGPCPFDIFKQYAQLTGTQALPPLF
SLGYHQCRWNYEDEEDVEKVDAGFDTFDIPYDVIWLDIEHTDGKRYFTWDKKRFSNPEKM
QKQILMKKKRKLVVIVDPHIKIDPLYTIYSQAKERGFFVKDRNGEDFEGICWPGLSSYLD
FTNPEVRQWYADQFDFKTYKGSSEIVFVWNDMNEPSVFRGIELTMSKDAVHYGKWEHRDV
HNLYGFYQQMATAEGLVKRSGGLERPFVLTRSFFAGSQKYGAVWTGDNKADWSYLKISIP
MLLTISIAGISFCGADVGGFIGNPEPELLVRWYQAGALQPFFRGHANMGTERREPWLFGD
KNTKIIREAIKERYSLLPYLYTLFYRAHSVAEPVMRPLWVEFPKELETFGIEDEYMLGSA
LLVHPVTAPKISTVNIFLPGPQEIWYDFRKFRHLEGHGILKIPVTLSNIPVIQRGGTIIP
LKISVGKSTEWMVDVPYELRAALDYKGCATGELYLDDGHSFHYLHEKQFLLRKFSFYDNV
LSSRCAGEEGLFQTKCIVQKILILGIKKEPSVVTTTKFDGKDDKAVAFAYDTKNSVLTLQ
KLSLNIGNNWELRIK
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagcagtcaagaaatcagtgtccaagatgaggctgtggacaaaagccaattt
aagacatgcaagcaaattgccttttacaggcgtcagaaacatttatgtcctggaaagtcc
ccataccaaaccttactgaaaactgtggaactatccaacagcaatctcaaattccaaatt
atcaatgaagagagcaaggtacctcttgcagtagaaatttatgaaatagagggcaatatt
ttcaggcttaaaataaatgaggtaaatccactcaagccaagatatgaagtccctgatgtt
ctcataaaagaaccagctagcttgagactgaagatatcagagaaagatgcagacaaactt
gtgctgacaggtcctgagcaagagcagcagattcatataatggcaaaaccttttcagata
cagcttatttctaaggatgaaattttactgagcatgaattccagtggcctgttgtatttg
gaacacctacagtcaccaccccaaaacaggaaatctacttcacaagaaaaggaaagtgga
ttggctgactcttctaaggaaaatgaagaagatttaggtctctgggaagaaaaaatcagc
agctttttagacatcaaagctaatggtcccagcagtgtaggtctagatgtttctttgcat
ggattcgaacatgtctatggaatacctcagcatgcagagaccctcctcttgaaaaacacc
agtgatgatgatgtctaccggctttataatgtggatgtctttggatataccatccacagc
aaaatgggcatttatggttcagtgcccttactcttagcacataagcctgatcagacaatt
ggagtcttctggctgaattcctcagaaacattggtggagatttctacaaaagctgcagtg
aaggttttaccttccaaaactccagacatctccaagcagagggtagtgcctcaaactgat
gtgcgctggatgtcagaaagtggaataattgatgttttcatcctaaaggggccctgtcct
tttgatatttttaagcagtatgcacagctaacaggcacacaggctttgcctccactcttc
tctcttgggtaccatcagtgccgctggaattatgaagatgaggaagatgtagaaaaggtg
gatgcaggttttgatacctttgacatcccttatgatgttatatggttagacattgagcac
actgatggcaagcggtacttcacatgggataagaagagattctccaatcctgagaagatg
cagaagcagatacttatgaagaaaaaacgcaagctggttgttattgtggacccccatatt
aagattgatcctctttatactatatactcacaagcaaaagagagaggattctttgtaaaa
gatcgtaatggtgaagattttgagggcatctgctggccaggtctctcatcttacctggat
ttcaccaatcctgaagtccgacaatggtacgctgatcaatttgacttcaaaacatacaag
ggttcttctgaaatcgtttttgtctggaatgatatgaatgagccttcagtcttcagaggg
atagaactaaccatgtcaaaagatgctgttcattatggcaaatgggaacatcgagatgtt
cataatctgtatggcttttaccagcaaatggcaactgcagaagggctggtgaaacgaagt
ggagggctggaaaggccctttgttctcacccgctctttctttgctggatcacagaagtat
ggtgcggtatggactggagacaataaagcagattggagttacttgaaaatctccattcca
atgttgctgacaatcagcattgcgggaatttctttctgtggagcggatgtaggtggcttt
attggaaatccagagccagaactactggttcgatggtatcaggctggggctttgcagcct
ttcttcagaggccacgccaatatgggtaccgagcgtcgtgaaccctggctgtttggggac
aagaataccaagatcatcagggaagctattaaggagcgttattctctgcttccttacctt
tatacgctgttctaccgggcacacagcgtggccgaaccagttatgaggcctctctgggtg
gaatttccaaaggaattagaaacttttggcattgaagatgaatatatgcttggaagtgct
ttgttggtgcatccagtcactgctccaaaaatcagtacagtcaatatctttcttccaggc
ccacaagagatttggtatgacttccgaaaatttagacatctagaagggcatggcatattg
aagatcccagtaacattgagcaatattcctgtaattcaacgcggtgggactattatacct
ctaaagatttctgtaggaaaatccacagaatggatggtagatgttccttatgaactgcgt
gctgctctcgattacaagggatgtgcaactggtgaactatacctggatgatggccactca
tttcattatctccatgagaaacagttcctgctcagaaagttcagcttctatgataatgtc
ctctcttccagatgtgctggtgaagaagggctatttcagacaaaatgtatagttcaaaag
atattgattttgggaataaaaaaggagccctctgttgtgacaacaaccaagtttgatgga
aaagacgacaaggcagtggctttcgcatatgataccaaaaactctgtgttgacacttcaa
aaactttccttaaacattggtaataactgggagcttcgtatcaaatga

DBGET integrated database retrieval system