KEGG   Python bivittatus (Burmese python): 103066892Help
Entry
103066892         CDS       T03091                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase isoform X1
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00430  Taurine and hypotaurine metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    103066892
Enzymes [BR:pbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     103066892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF4910 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103066892
NCBI-ProteinID: XP_025026945
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MAAEDTLSSPGLDQVAGETFLQEAFQIMLEEGIRKGMDTSEKVCIWKEPEELQQILDLDL
KDSGEPHEKLLERCRDVIRYSVKTCHPRFCNQLFSGLDPHALAGRMITEMLNTSQYTYEI
APVFVLMEEVVLKKLRELIGWEKGDGIFCPGGSISNMYAMNVARYHRFPDCKQKGHWTIP
KLAVFTSEECHYSIQKGAAFLGIGTDNVYLVAVDEKGKMIPADLEKQINEAKSERAVPFF
VNATCGTTVLGAFDPLPEIAEVCMRHKLWLHVDAAWGGSALLSQRHRHLLDGIERADSVA
WNPHKMLMTGLQCSAFLLRDSSGLLQRCHCAQATYLFQTDKFYNIAFDRGDQTIQCGRKV
DCFKLWLMWKANGSKGLEQRVDRAFAYTRYLADEIKKREGFQLVIEPEFINLCFWYVPPS
LRGQEGCADYWLKLGKVAPLIKEQMMKKGSMMVGYQPHGKRANFFRQVVTNPAVTREDLD
FFLDEIERLGRDL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagaagatactttgtcatctcctggcttggatcaggtagctggtgagacgttc
ctgcaggaagccttccagatcatgcttgaagaaggaattcgaaaagggatggatacctct
gaaaaggtgtgtatttggaaggaacctgaggaactgcaacaaattctggacctggatcta
aaagacagtggggagccacatgaaaagttgctggaacgctgtcgggatgttatcagatac
agtgtgaaaacatgtcatccacgcttctgcaatcagctattttctgggcttgatccccat
gctctggctggacggatgatcacagagatgctcaacactagccagtacacgtatgagatt
gcacctgtctttgtcttgatggaggaggtggtgttgaagaaactgcgagagctgattggc
tgggaaaaaggcgatggaatcttctgccccggagggtccatctccaacatgtatgccatg
aacgtggcacggtatcaccgtttcccagactgcaagcagaaggggcattggacaatacca
aagctggcagtgtttacatcagaagagtgccactactccatccaaaagggagcagctttc
ttgggcattggcacagataatgtctaccttgtagcagtggatgaaaaagggaaaatgatc
cctgctgatctggagaaacagatcaacgaggccaaatcagagagagcagtccccttcttt
gtcaatgccacctgtggcaccactgtcctgggagcctttgaccccctgcctgagattgca
gaggtgtgcatgagacacaaactctggctccatgtggacgcagcctggggtggcagtgct
ctcctctcccaaagacaccggcatcttctggatgggattgagagggcagattcggtggct
tggaatccccacaaaatgcttatgactgggcttcagtgttctgccttcctcctccgagac
agctctggcctgctgcagagatgtcactgtgcccaagccacctacctcttccagacagac
aagttctacaacatagcttttgacagaggagaccaaacaatccagtgtggacgcaaagta
gattgttttaagttgtggctgatgtggaaggccaatggcagcaaaggcttggagcagaga
gtggatagggcttttgcctacactaggtatctagctgatgagattaagaagagagaaggc
tttcagctagtgatagagccagagttcattaatctctgtttttggtacgtacctcccagt
ctacgagggcaagaaggctgtgccgattactggctgaaactggggaaggtagctccactg
atcaaggagcagatgatgaagaaaggatccatgatggtgggctaccagccacacggcaaa
agggcgaacttcttccgccaggtggtcaccaatccggcagtcaccagagaggatctggat
ttcttccttgatgaaattgagaggcttggcagagacctgtag

DBGET integrated database retrieval system