KEGG   Python bivittatus (Burmese python): 103067160Help
Entry
103067160         CDS       T03091                                 

Gene name
MAP3K9
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 9 isoform X1
  KO
K04417  mitogen-activated protein kinase kinase kinase 9 [EC:2.7.11.25]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103067160 (MAP3K9)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103067160 (MAP3K9)
Protein kinases [BR:pbi01001]
 Serine/threonine kinases: TKL group
  MLK family
   103067160 (MAP3K9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103067160
NCBI-ProteinID: XP_025022495
LinkDB All DBs
Position
Unknown
AA seq 856 aa AA seqDB search
MLEVDFSELILEEIIGIGGFGKVYRAVWFGDEVAVKAARYDPDEDISEAIENVHQEAKLF
AMLKHPNIIALKGVCLKEPNLCLIMEFARGGSLNRVLSGKRIPPDILVNWAVQIAEGMNY
LHEEAIVPIIHRDLKSSNILILERVENGDLSNKNLKITDFGLAREWHKTTKMSAAGTYAW
MAPEVIRSSMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLSLPIPSTCP
EPFTRLMEDCWNTDPHSRPSFANILNKLTNIEESGFFEMPKESFHSLQEDWKIEIQEMFD
QLRAKEKELRTWEEELKQAAVQQKNHEELLRQREQELAEREIDILERELNIIIHQLCQEK
PRVRKRMGKFKKNRLKLKDGNHISLPSDFQHKFTVQASPTMDKRKNLINNCASPPASPTI
IPRLRAIQLTPGESSKTWGRSSVFQKDEEGEEEKRGQKKKGRTWGPGSLCNKELTSSEDG
LKSLADGARHWSSSAPNLGKFQRTIVPFPGFASLIEMDNEDNDSLNDRESKVQQSPGFNQ
SYLCIPFQKNDDWDAQSSDPNEETTPMNSSTSTPQLTPTNSLKRGGSQYKQCQLAFLGCG
AVLAAAGLGFDLLEAGKCQLLTQEDQDVSKEEKKKRESIFQRAGLSRRSTSPPSRKVFKK
EEPTFLLGEPSSSLTLLSLSSISECNSTRSLLHSDSDEIVVYEMPVSPVTVKAPLPIVSN
PLVNIRVERFKQNPNQSLTPTHVTLSSEAQQQKHRRTPSDGAIKLSDLVSNADSSSNSPT
GVLEAAVAALLKSSPHCFLFMPDCLKRSGHCWTWTLKVRVRTAQCRYAEQNSERINLQHM
NSSKNFGPSMKFTRGW
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgttggaggttgacttctcagagctgattctggaggaaatcattggcataggaggtttt
gggaaggtttaccgtgcagtttggtttggagatgaagttgctgtcaaggcagctcgctat
gatccagatgaagacatcagtgaagctattgagaatgtccatcaagaagccaagctcttt
gctatgctaaaacatcccaatataattgcccttaaaggtgtgtgtctaaaggaaccaaac
ctttgtctgattatggagtttgcccgtggaggctcattaaatagagtgctgtctggcaaa
aggattccaccagacattctggtgaactgggctgtccagattgctgaaggaatgaactat
ctgcacgaggaagcaattgttcctattatccaccgggatctgaagtccagcaatatattg
atacttgaaagagtggaaaatggagacctgagcaacaaaaatttgaagatcactgatttt
ggcttggccagagaatggcataagactaccaaaatgagtgcagctggaacatatgcctgg
atggctcctgaagttatccgttcctccatgttctctaaaggcagtgatgtgtggagttat
ggggtattgctttgggaactgctaactggggaagtaccatttcgaggaattgatggcctg
gcagtagcatacggtgttgctatgaataaactttcccttcctattccttcaacgtgccca
gaacctttcaccagactgatggaagattgttggaatactgatcctcattcaaggccgtct
tttgccaatattttgaataaactaactaacatagaggaatctggtttctttgaaatgcca
aaagaatcctttcattccctgcaagaagattggaaaattgagatccaggagatgtttgac
caactcagagccaaagaaaaggagttgcggacatgggaagaagagttaaaacaagcagcc
gttcaacagaagaaccatgaggaactactacggcaacgagagcaggagttggcagagcga
gaaatcgatattttggaaagagaactcaacataatcatccaccaactgtgccaggaaaag
ccccgggtgagaaaacgcatgggcaagttcaagaaaaatcggctgaagttgaaagatggc
aatcacatcagtcttccttctgatttccagcacaaattcaccgtgcaggcatctccaacc
atggataaaagaaaaaacttgatcaacaactgtgccagtcctcctgccagccctactatc
attcctaggctcagagccatccagctaacccctggtgaaagcagcaaaacatggggacgc
agctctgtattccagaaagatgaggaaggagaagaagaaaaaagagggcagaagaaaaag
ggtcggacgtggggcccaggttcactttgcaataaggagctaacatcaagcgaggatggc
ctaaagtccctggcagatggcgctagacactggtcttctagtgctccaaatcttggaaaa
ttccagcgaacaatagtcccttttcctggatttgcaagcctaatagagatggacaatgaa
gacaatgattctttgaatgacagagaaagcaaggtgcagcagtcccctggatttaaccaa
tcatacctctgcatcccatttcagaagaacgacgattgggatgcccagtccagtgatcct
aatgaagagactactcctatgaactcttccacaagcactcctcagctaactcccaccaac
agcctcaaacgtgggggctcccagtataaacagtgtcagctggcctttctaggctgtggg
gctgtgctggctgctgctggcctaggctttgaccttttggaggctggcaagtgccagctg
ctaacccaggaagatcaggacgtgtccaaggaagaaaagaagaagcgtgaaagcatcttc
caacgggctggtctctctcggaggagtacaagcccaccttcaaggaaggtcttcaagaaa
gaggaacccacattcttgttgggcgagccatccagttctctaactctactctctttgtct
tcaatttctgaatgtaactctacccgttccttacttcattcagacagtgatgaaattgtg
gtatatgagatgcctgttagtcctgtgacagtgaaggctcccttaccaatagttagtaac
ccactagttaatatccgagttgagagattcaaacagaatcccaaccagtccttgacacct
acacatgtgactctttcttctgaagcccagcaacagaagcataggcgcactccctctgat
ggtgccataaaactgtctgatcttgtttccaatgcagattcttccagtaattctccaaca
ggagtgctggaagcagcagtagcagcactgttgaagagcagtccacactgctttcttttc
atgccagactgcctgaagaggagcggacactgctggacatggacgttgaaggtcagagtc
aggacagcacagtgccgttatgcagaacagaactcagaacgcataaacctgcagcatatg
aactcaagcaagaattttggtcctagcatgaaattcacaaggggttggtaa

DBGET integrated database retrieval system