Python bivittatus (Burmese python): 103067387 Help Entry 103067387         CDS       T03091                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism pbi  Python bivittatus (Burmese python) Pathway pbi03030   DNA replication pbi03082   ATP-dependent chromatin remodeling pbi03410   Base excision repair pbi03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pbi00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103067387 (POLE3)    03410 Base excision repair     103067387 (POLE3)    03420 Nucleotide excision repair     103067387 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103067387 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pbi03032]     103067387 (POLE3)    03036 Chromosome and associated proteins [BR:pbi03036]     103067387 (POLE3)    03400 DNA repair and recombination proteins [BR:pbi03400]     103067387 (POLE3) Enzymes [BR:pbi01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      103067387 (POLE3) DNA replication proteins [BR:pbi03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     103067387 (POLE3) Chromosome and associated proteins [BR:pbi03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     103067387 (POLE3) DNA repair and recombination proteins [BR:pbi03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       103067387 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  103067387 NCBI-ProteinID:  XP_025022882 UniProt:  A0A9F5MXK0 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MEEMEFQRFVGPLKESLEAYRNEQKGKRGASELKKKDKEKKEDSEDPDKNREEENEEGER MEEEEEEEEEEEEEQQQNEEEQQQQQQNEEEQEEVES NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggaagagatggaattccagcgatttgtaggaccgctaaaggaatccttggaagcttac aggaacgagcagaagggcaaaaggggagcgtcagagctcaagaaaaaagacaaagagaag aaggaagattctgaagaccctgacaagaatcgggaagaagaaaatgaggagggagagagg atggaggaagaggaggaggaggaggaggaggaggaggaagagcagcagcaaaatgaggag gagcagcagcagcagcagcaaaacgaggaggagcaggaggaagtggagagctga

DBGET integrated database retrieval system