KEGG   Python bivittatus (Burmese python): 103067398Help
Entry
103067398         CDS       T03091                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
pbi  Python bivittatus (Burmese python)
Brite
Enzymes [BR:pbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103067398 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core DUF5306
Motif
Other DBs
NCBI-GeneID: 103067398
NCBI-ProteinID: XP_007434172
LinkDB All DBs
Position
Un
AA seq 641 aa AA seqDB search
MTEPTATENKKPPAGLSGRRAIPPNVSNAEEDEVPEVETIGVVPRGFKREDVLEVQDVNL
FSREYEINKKEHHTDKYYHFKLIVRRGQIFHLQITFSRAYNPEKDQFWIEYLIGRYPQQN
KGTYIPVPLVQELESGKWGAKITHRANNSVALNIMPAANCIVGKFRMYVAVLTPMGILRT
RRNPDTDTYILFNPWCTEDAVFLDEEKAREEYVLNDLGVIFYGDPENIRSRSWNYGQFEE
GVLDACLYLMDRAQLDLAGRGNPVKISRVGSAMINSKDDEGVVYGSWDNVYDYGVAPSAW
TGSVDILLEYYSTKQPVRYGQCWVFAGVFNTFLRCLGIPGRVITNYSSAHDNDANLQMDV
FVDEHGKVDSKLTRDSIWNYHCWNEAWMSRPDLPVGFGGWQAVDSTPQENSDGMYRCGPA
SVQAIKHGHVCFQFDAPFVFAEVNSDVIYSKAMKNGTKVVQHIDKTQIGKLILTKEVGTN
EMKDITEHYKFREGTEEERLALETALMYGVKKSETEDASSSTEVDMNIVVEDSTLGSDFT
VTITFQNKTPRRYTATAYISGNVVFYTGVSKTQFKDDSFDVTLEPMKVETLEVLIESSEY
MSKLVEQAFLHFFVTARVNELQKILARQKTVSLKIPQLLLK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgacagagccaacagccactgagaataagaaacctcctgctggtttgagtgggcgaaga
gccatcccacccaatgtctccaatgcagaagaagatgaagtacctgaagtagagacaatt
ggtgtggtgccaagaggatttaagagagaagatgtcctggaagtccaagatgtcaattta
ttcagccgtgaatatgaaattaataagaaagagcaccacacagacaaatactaccatttc
aaactgattgtgcgccgaggacagattttccatcttcagattacattcagtcgtgcatac
aatccagagaaggaccaattctggattgagtatcttataggacgatatccacaacaaaac
aaaggcacctacatcccagttcctttggttcaagagctggaaagtgggaaatggggtgct
aagatcacccacagggccaacaattctgtggccttgaatattatgccagctgcaaactgc
attgtgggaaaattccgcatgtatgttgcagtattgactccaatgggcattctcagaaca
agacgaaacccagacactgatacttacatattgttcaatccctggtgtacagaggatgca
gtgtttctggatgaagaaaaagcaagagaagagtatgtcctgaatgaccttggggttatt
ttctatggggaccctgaaaatataagatcgaggagttggaactatggtcagtttgaagaa
ggagttttggatgcttgcctatacttgatggacagagcacaactggaccttgctggccga
gggaatcctgtcaaaatcagccgtgttggctctgctatgatcaactctaaagatgatgag
ggtgtagtttatgggtcttgggacaacgtttatgattatggagtggccccatcagcttgg
actggaagcgtagacattctattggagtattacagtactaaacagccagtgcggtatggg
cagtgctgggtctttgctggcgttttcaatacttttctgagatgtctaggaattcctggg
cgagtcataactaactattcttcagctcatgataatgatgccaacttacagatggatgtg
tttgtggatgaacatggaaaggtggactccaaactcacaagagattcaatctggaactat
cattgctggaatgaagcttggatgtcccgacctgaccttcctgttggttttggtggctgg
caagctgtagatagtactcctcaagaaaacagtgatggcatgtatcggtgtggtccagct
tctgttcaagccatcaagcatggacatgtctgtttccagtttgatgcaccttttgttttt
gcagaggtgaacagtgatgttatatattcaaaagcaatgaagaatggaactaaagtggtt
caacatattgacaaaacccagattggaaaattaattttgactaaagaagtgggtacaaat
gaaatgaaggacatcactgagcattacaaattccgagaaggtacagaagaagaaagactg
gccctggagactgccttgatgtatggggttaaaaaatctgaaactgaggatgcctcatcc
agtacagaggttgacatgaatattgtggtggaagactcaactcttggcagtgatttcact
gtcactattacttttcaaaacaaaaccccaagacgctacactgcaacagcttatatttct
ggcaatgttgtgttttatactggagtctcaaagactcaattcaaggatgacagctttgat
gtgacgctggaacccatgaaagttgaaactcttgaggtgctaatcgagtcaagcgagtac
atgagcaagttggtggaacaagctttcctacatttcttcgtcacggcccgtgtcaatgaa
ctacaaaagatcctggcccggcagaagactgtttcactgaaaatcccccaattgctcctc
aag

DBGET integrated database retrieval system