KEGG   Python bivittatus (Burmese python): 103067713
Entry
103067713         CDS       T03091                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi04010  MAPK signaling pathway
pbi04020  Calcium signaling pathway
pbi04144  Endocytosis
pbi04510  Focal adhesion
pbi04540  Gap junction
pbi04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103067713 (PDGFRA)
   04020 Calcium signaling pathway
    103067713 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103067713 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103067713 (PDGFRA)
   04540 Gap junction
    103067713 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103067713 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbi01001]
    103067713 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pbi04090]
    103067713 (PDGFRA)
Enzymes [BR:pbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103067713 (PDGFRA)
Protein kinases [BR:pbi01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103067713 (PDGFRA)
CD molecules [BR:pbi04090]
 Proteins
  103067713 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set Ig_2 ig Herpes_gE V-set Kinase-like
Other DBs
NCBI-GeneID: 103067713
NCBI-ProteinID: XP_007437249
LinkDB
Position
Unknown
AA seq 1085 aa
MGPSQKEFLILGYLLAGSCIISCQPLLPMILPNEEEMVVQLNAPFTLKCSGDSEVSWQHP
VPEGNQSIIIRNEENNSGLFVTILEVANASASLTGLYICYYNHSQEEDGEVEGKEIYIYV
PDPAVPFVPTSPEDLFIVVTEEDNSSIIPCRTTDPKAQVTLMNSEGRVPYASYDNRLGFI
GNFSSGSYICKTTVKAVEFESGEFFIYVYKAPSYLHVEIESLKTVYKTGETIIVTCVVLD
NEVVNLEWNYPGKVKNKGIITLEDIKVPAQKLIYNLTIPDASVKDSGDYECAVRHVTKDF
KKTERIVIYVHDKGFIHLEPHFKPTEAVNLHEVKNFVIYVYAYPEPKLFWLKDNVTLMEN
LTEIVTSSKQIQETRYQSILKLIRAKEEDSGYYTLVAQNEDEIQRYTFSLLIQVPALIRD
LVDNHHGSAGQTVKCVAEGTPLPDVEWLVCKDIKKCNNDTSWTLLTNNISDITVETHLDE
RNMVASQVTFQKVEEIMAVRCMAKNDLRTVTRELKLVAPTLRSELTVAAAVLVLLVIVII
ALIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKAKKDLDIFGMNSADESTRSY
VILSFENNGEYMDMKQAETTQYVPMLERKDRSKYSDIQRSLYDRPASYKKKSVLDVKNLL
SDDNSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARD
IMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVD
STFYNKIKSGYRMAKPDHATSEVYDIMVKCWNSEPEKRPSFYHLSEIVENLLPGEYKKSY
DRIHLDFLKSDHPAVTRMRVDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIPLP
DIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFVKREDETIDDIDIIDDIGMDSSELV
EDSFL
NT seq 3258 nt   +upstreamnt  +downstreamnt
atgggtccttcccaaaaagaattcttgatcttgggctaccttcttgcagggtcatgcata
atctcttgccagcctttgcttcccatgattcttccaaatgaagaggaaatggttgtgcag
ctgaatgcccccttcactctgaaatgttctggagacagtgaagtgagctggcaacatcca
gtcccagaaggcaaccagtctataatcatcagaaatgaagagaacaacagtggtcttttt
gtgaccatccttgaagtggcaaatgcttcagcttctctcactggattatacatttgttat
tataatcattctcaggaggaagatggggaggtggaggggaaggagatctacatctatgtg
ccagatccagctgttccctttgttccaacctccccggaagatttgttcattgttgtcact
gaggaagacaattcttcaattatcccatgtcgcacgactgatcctaaagctcaagtcact
ctgatgaacagtgaaggaagagtcccatatgcctcttatgacaacaggctgggcttcatt
ggaaacttctcttcagggtcctatatatgcaagacaacggtcaaagcagtagaatttgag
tctggtgaatttttcatctatgtttacaaagctccatcataccttcatgttgaaattgaa
tccctcaagactgtgtataaaacaggagaaaccattattgttacttgtgtggtcttggat
aatgaagtggtgaacttggagtggaattatccagggaaagtgaagaataaaggaataatc
acccttgaagacatcaaggttccagcccagaagctgatttataatttaaccattccagat
gcatcagtaaaggacagtggagattatgaatgtgctgttcgacatgtgaccaaagatttt
aagaaaactgaaagaatagtcatctatgttcatgataaagggttcattcatttggaaccc
catttcaagcccacagaagctgtcaacctacatgaagttaaaaactttgttatttatgtc
tatgcatacccagagccaaaattgttttggctgaaggacaatgtcactctgatggagaat
ctcacagagattgttaccagttccaagcaaatccaagaaacaagatatcagagtatatta
aaattaattcgtgccaaggaagaagacagtggatattatacacttgtagcacagaatgaa
gatgaaattcaaagatatactttctctctgctcatacaagttccagctttaattcgagac
ctggtagataatcaccatggctctgctgggcagacagtaaaatgtgtggcagaagggaca
cccctccccgatgtggaatggctggtttgcaaggacattaaaaaatgcaacaatgatacc
tcatggactctcctgaccaacaatatctctgacattacggtggagactcatcttgatgag
aggaacatggtagccagccaggtgacttttcaaaaggtggaagaaataatggctgttcga
tgtatggcaaagaatgaccttcgtactgttacaagggaactaaagcttgtggctcccaca
ttaagatcggaactaactgtggctgctgctgtcctagtactgcttgtgattgtaatcatt
gcgctgattgtcttggtaatcatatggaaacagaaacccagatatgagatcagatggcga
gtcattgagtccattagtcctgatggccacgaatacatctatgtggatcctatgcaacta
ccctatgactcaagatgggaattccctagagatggattagtgttaggccgaatccttggt
tctggagcttttgggaaagtagttgaaggaactgcgtatggattgagccggtcacaacca
gtgatgaaagtagctgtgaaaatgttgaaaccaactgcaagatccagtgaaaagcaggct
ctcatgtctgaattaaagataatgactcatcttggtccccacttgaacattgtcaacctc
ttaggagcttgcacaaaatcaggtccaatatacatcataacggaatactgcttttatggg
gacttggtgaactacctgcataaaaatagggataactttctgagccgacatcctgaaaag
gccaagaaggacctggacatctttggtatgaactctgcagatgaaagcactagaagctat
gtcatcctgtcctttgaaaataatggtgaatatatggacatgaaacaagcagagacaact
cagtatgtgcccatgttagaaagaaaagacaggtcgaaatactctgacatccaaagatct
ttgtatgatcgccctgcttcatataagaaaaaatctgtgttggatgttaagaacctcctt
tctgatgataattcagaaggcctcagtttgttggatctgctgagcttcacataccaggtg
gcacggggaatggagttcctggcttcaaaaaattgtgtgcaccgtgatctggcagcacga
aatgtcctcttggctcaagggaaaattgtgaagatctgtgactttgggctagcgagggac
atcatgcatgattcaaactatgtatccaaaggcagtacctttcttccagtgaaatggatg
gcacctgaaagcatttttgacaacctgtataccacattaagcgatgtctggtcatatggc
atcctgttgtgggaaatattttctcttggtggcaccccatacccaggcatgatggttgac
tctaccttctataataaaataaaaagtggctatcggatggcaaaaccagatcatgctacc
tctgaggtgtatgacatcatggtgaagtgctggaatagtgaacccgaaaagagaccttct
ttttaccacttgagtgaaatagttgagaatctgttgcctggtgaatacaagaagagttac
gatagaattcatttggacttcttaaagagtgaccatcctgctgtcacacgcatgagagta
gactgtgacaatgcatatattggtgtcacttacaagaatgaggacaaactgaaagacagg
gagagtggatttgatgaacaaagactcagcgcagacagtggctatataattccactgcct
gatattgaccctgtatcagaagatgaacttgggaaaaggaacaggcacagttctcagaca
tctgaggaaagtgccattgaaaccggatccagcagttccacgtttgtgaagcgagaagat
gaaaccattgacgacattgacattattgatgatattggaatggattcctcagaactagtt
gaggacagcttcctgtaa

DBGET integrated database retrieval system