KEGG   Python bivittatus (Burmese python): 103068198Help
Entry
103068198         CDS       T03091                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
pbi  Python bivittatus (Burmese python)
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbi01002]
    103068198 (TMPRSS2)
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103068198 (TMPRSS2)
Peptidases [BR:pbi01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103068198 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Hepsin-SRCR Ldl_recept_a SRCR Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103068198
NCBI-ProteinID: XP_007441832
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MASNLRPAPYYENYAYQAENVAPPRFPRDYNVYLHNTPTYYPSSGPHYVPRVSTQQSIPV
PVVQAKSAKCTPRTKKALCLLLSIAILIIGAGISVFLIWYFVIDSCFGSKIQCGATRVCV
TPSQWCDGKKDCPNGEDENRCVRLYGPEFLLEVYLSENKDWYSICYDDWNDKYGETACED
LGYNSNTYFNSKAIPISSGSANILRVNTSAGDIDLYKKLYNSNWCPSEHAVSLRCIRCGT
SNIRTSPQNRIVGGNAALRGEWPWQVSLHIQRTHLCGGSIITPEWIVTAAHCVEGAHSDP
SYWTVYAGILRQSEMIPSKGFRVARIISHPNYDSASKNNDVALMKLQYPLSFNEFIGPVC
LPNAGMMFETDQQCWISGWGAKYQGGNTSKELNAALVPLIDSSICNGRYFYNGIILPTMI
CAGYLQGKVDSCQGDSGGPLVTMKNVLWWLVGDTSWGTGCATQFKPGVYGNITMFTEWIY
RNMQANR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcatctaacttgaggccagctccatattatgaaaactatgcctaccaggcagaaaat
gttgctcctccaagatttcccagagactataatgtgtatctacataacacgcctacatat
tatccttcatcagggcctcattatgttccgagagtttctactcaacagtcaattccagtg
ccagtagtgcaggccaaatctgcaaaatgcacaccaagaaccaaaaaggcattgtgtctc
cttctatcaattgcaatactaataataggagctggaatttctgtttttctcatctggtat
tttgtgatagatagttgttttggctccaagatacaatgtggtgcaacaagagtgtgtgta
acaccatctcagtggtgtgatggaaaaaaagattgtcctaatggtgaagatgaaaaccgt
tgtgttagactttatggaccagaatttctcttggaagtctatttatctgaaaacaaagat
tggtactctatatgctatgatgattggaatgataaatatggagagaccgcatgtgaagac
ttgggatataactcgaacacctatttcaacagcaaagcaatccccatttccagtggatct
gcaaacattttgagggtcaatactagtgctggggacatagacctgtataagaaattgtat
aacagcaactggtgtccatcagagcatgcagtatctctgcgatgcataaggtgtggcaca
tcaaatatacgtacaagtccccaaaacagaattgtgggtggaaatgctgcattgcgtgga
gaatggccgtggcaagtcagccttcatatccagaggactcatctctgtggagggtctatt
attacccctgaatggatagtaacagcagctcattgtgtagaaggggcacattctgatcca
tcctactggacagtttatgctgggattctgagacagtcagaaatgattccttcaaaggga
tttagagtagccagaataatttctcatcccaactatgattcagcttccaaaaataatgat
gttgctcttatgaagctacaatatcctctaagttttaatgaatttataggacctgtttgt
ttgcccaatgctggaatgatgttcgagactgaccaacagtgttggatatctggatgggga
gccaaataccaaggaggtaacacttcaaaagaattgaatgcagcgcttgtacctctgata
gactcatctatatgtaatggaaggtatttttataatggaatcattttgcctacgatgata
tgtgctggctacttacaaggaaaagtggattcttgtcagggtgatagcggtggtccattg
gtaaccatgaaaaatgttttgtggtggctagtgggtgacacaagttggggaacaggctgt
gctactcaatttaaacctggagtttatggtaacattactatgttcacagaatggatttac
cgaaatatgcaggcaaacagatga

DBGET integrated database retrieval system