KEGG   Python bivittatus (Burmese python): 107326357Help
Entry
107326357         CDS       T03091                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00562  Inositol phosphate metabolism
pbi01100  Metabolic pathways
pbi04068  FoxO signaling pathway
pbi04070  Phosphatidylinositol signaling system
pbi04115  p53 signaling pathway
pbi04140  Autophagy - animal
pbi04150  mTOR signaling pathway
pbi04218  Cellular senescence
pbi04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:pbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107326357
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107326357
   04070 Phosphatidylinositol signaling system
    107326357
   04150 mTOR signaling pathway
    107326357
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107326357
  09143 Cell growth and death
   04115 p53 signaling pathway
    107326357
   04218 Cellular senescence
    107326357
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107326357
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbi01009]
    107326357
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107326357
    3.1.3.48  protein-tyrosine-phosphatase
     107326357
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107326357
Protein phosphatases and associated proteins [BR:pbi01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107326357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2
Motif
Other DBs
NCBI-GeneID: 107326357
NCBI-ProteinID: XP_015745233
LinkDB All DBs
Position
Unknown
AA seq 137 aa AA seqDB search
DKMFHFWVNTFFIPGLEENSDKVENGSLLGDQELDGIFSTERSDNDKEYLILTLTKNDLD
KANKDKANRYFSPNFRVKLFFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSD
PENEPFDEDQHTQITKV
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
gacaaaatgtttcatttctgggtcaatacattcttcataccaggactggaagaaaattct
gacaaagtagaaaatggaagtcttcttggagatcaggaacttgatggaattttcagtaca
gagcgttcagataatgacaaggaatatttaatccttacactaacaaaaaatgatttggac
aaggcaaataaggacaaggcaaatcgatatttttctccaaactttagagtgaagctattt
ttcacaaaaacagtagaagagccatccaacccagaagctagcagctcaacttcagtaaca
ccggatgttagtgataatgaacctgatcactataggtattctgacaccactgactctgat
ccagagaatgaaccttttgatgaagatcagcatacacagattactaaagtctga

DBGET integrated database retrieval system