KEGG   Paenibacillus beijingensis: VN24_01305Help
Entry
VN24_01305        CDS       T03802                                 

Definition
(GenBank) amino acid racemase
  KO
K18348  serine/alanine racemase [EC:5.1.1.18 5.1.1.1]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj01502  Vancomycin resistance
pbj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VN24_01305
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VN24_01305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:pbj01504]
    VN24_01305
Enzymes [BR:pbj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VN24_01305
    5.1.1.18  serine racemase
     VN24_01305
Antimicrobial resistance genes [BR:pbj01504]
 Gene sets
  Vancomycin resistance modules
   Vancomycin resistance, D-Ala-D-Ser type [MD:M00652]
    VN24_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Acyl_transf_3 DUF2919 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AJY73508
UniProt: A0A0D5NF13
LinkDB All DBs
Position
complement(278602..280749)
Genome map
AA seq 715 aa AA seqDB search
MAKISHGEVDRFKLIAAILVIAIHTGPFISYSPSADFILTGIVARLAVPFFFMASGYFFF
GRMKGEKAQERAALKRFMLRIGLLYGAGFLMYLPLNVYAGHFNEPWSIASLAKDIVFDGT
FYHLWYLPALMTGTCIVYWLRAKTTDRYVLVVASVLYVFALLGDSYYGLAAQIGFLSSFY
DHLFEWFDYTRGGIGFAPLYIALGASAANRDEKSRSGNWYAAAFLVSMGLLLAEGIVLHE
AGYPRHDSMYIALVPAVYALFRLLLTWGGRERRFMRQASTWVYMLHPLAIVLIRGIAKLT
GLEPVLVKDSLVHFLAVTALSMLLSSAVVFLAGIRRTKVANKIPGTDRAWAEINLEHLDH
NLRELKNALPPSTQIMAVVKAEAYGHGSIRIAKRLYRAGVRCFAVAEIDEGIKLRRKGVR
GEILILGYTPTHRLGDVVRFRLTQTAVSANDAERLQAFGKKIKVHIKIDTGMNRLGEPYD
DTERVLSMYRHSRLKVTGTFSHLAAADSLEQEDVAFTRMQIERFESIVRQVRAVGFRPGM
VHLQSSYGILNYSELNLDVARPGIALYGLLSSECDRIRADVDLRPVLTLKARVTRVNGVR
AGESVGYGRSFTAPLDCKVATVSIGYADGIPRELPERGGCVLIHGQRARIVGKMCMDQMM
VDVTDINDVRQGDPVTLIGQDGENRITAGEIAEMAGTITNEVVSALGARVSRIFI
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggctaagattagccatggagaggtggatcgcttcaagctgatcgccgccattttagtc
attgccatacataccggaccgttcatctcttacagcccaagcgcggattttattttgacc
ggcatcgttgcacggcttgcggttccgttcttttttatggcatcgggctactttttcttc
ggcaggatgaagggagagaaggcgcaggagcgggcggcattgaagcgattcatgctccgc
atcggtttgctgtacggggcgggctttctgatgtacctgccgctgaacgtttatgccggg
catttcaacgaaccgtggagtattgcctcattagcgaaagacattgtgttcgacggcacg
ttttatcacttgtggtatcttccggctcttatgacaggcacttgcatcgtctattggctg
cgcgccaagacaacggaccgctatgtgctggttgtggcaagcgtactgtatgtcttcgcg
ctgctcggagacagctattacgggcttgccgctcaaatcggcttcctctcttccttttac
gatcatctattcgaatggttcgattataccaggggcggcatcggcttcgctcccctgtac
attgccttgggagcttcggccgccaaccgcgacgaaaagtcccgatccggcaattggtat
gcggctgcatttttggtctcgatggggctgctgctggctgaagggattgtgctgcacgag
gcaggttatccccggcacgacagcatgtatatcgctttggttccggccgtttacgccctg
tttcgcctgctgcttacgtggggaggccgcgagcgacggtttatgagacaagcaagcacc
tgggtttatatgcttcacccgcttgccatcgtcctcattcgcggcattgccaagctgacc
ggacttgagcctgtcttggtcaaagacagcctcgttcacttccttgccgttacagctttg
tcgatgcttctatcgtctgcggtcgttttcctggccgggataaggagaactaaggttgcc
aacaagattcccggcacggatcgggcatgggcggagatcaacctggagcatttggatcat
aatttacgggaactgaagaacgcgctgccgcccagcacgcaaatcatggccgttgtcaaa
gcagaggcttacggccatggtagcattcgaattgcgaagcggctttacagggcgggcgta
cgctgcttcgcggttgcggagatcgacgaagggataaagcttcgccggaagggtgtccgc
ggagaaattctcatcctcggctatacgcccacgcatcgtcttggcgatgttgtccgcttc
aggcttacgcagacggccgtcagcgccaatgatgcagagcggcttcaagcattcggcaag
aaaataaaggttcatattaaaatcgataccggtatgaaccggctcggcgagccgtacgac
gatacggagcgggtgctgtccatgtaccggcacagccggctgaaagtaaccggcaccttc
agtcatctggcggcggcggacagcctggagcaggaggatgtcgccttcacccgaatgcaa
atcgagcggttcgaaagcattgtcaggcaagttcgtgccgtgggcttccgtcccggcatg
gttcatcttcaaagcagctacggcattctgaactattccgagcttaaccttgatgtggcg
cggcccggcattgcactttacggtctgctgtccagcgagtgcgaccggattcgcgcagac
gtcgaccttcgcccggttttaacgctgaaggcgagggtgacgagggtgaacggcgttcgc
gcgggcgaatccgtcggctatggcagaagcttcaccgcaccgctcgactgcaaggtggcg
acggtatcgatcggttatgccgacggcattccaagggagctgccggaaagaggcggctgc
gtgctcattcatggtcagcgggcgagaatcgtcggcaaaatgtgcatggaccagatgatg
gtggacgtaacggatattaacgatgtccgccagggcgatccggtaacgctgatcggacaa
gacggcgaaaaccggattacggccggggaaatcgccgaaatggccggcacaattacgaac
gaagtggttagcgccctcggggcgcgggtttcgcgaatttttatttaa

DBGET integrated database retrieval system