KEGG   Paenibacillus beijingensis: VN24_03420Help
Entry
VN24_03420        CDS       T03802                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00970  Aminoacyl-tRNA biosynthesis
pbj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VN24_03420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pbj03029]
    VN24_03420
Enzymes [BR:pbj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     VN24_03420
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     VN24_03420
Mitochondrial biogenesis [BR:pbj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    VN24_03420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln YPEB
Motif
Other DBs
NCBI-ProteinID: AJY73838
UniProt: A0A0D5NFZ8
LinkDB All DBs
Position
complement(716158..716445)
Genome map
AA seq 95 aa AA seqDB search
MSITLQDVEHVAGLARLDLSEEEKDIFTGQLNAILKYVEKLSELDTDGIEPTSHVLPIAN
VMREDEVKPSIDVEKALLNAPDDEDGQFKVPAVLD
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgagcataacgcttcaggacgtcgaacacgtggcgggcctcgcccggcttgatttgagc
gaagaggaaaaagatattttcacaggacaattgaatgcgatcttaaaatatgtggaaaag
ctcagcgagctggataccgacggcatagagccgaccagccatgtgcttccgatcgccaat
gtgatgcgggaagacgaagtaaagccgtccattgacgtggagaaagcgctgctgaacgcg
cccgacgatgaagacggccagtttaaggtgccggccgtgctggactaa

DBGET integrated database retrieval system