KEGG   Paenibacillus beijingensis: VN24_04095Help
Entry
VN24_04095        CDS       T03802                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    VN24_04095
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pbj03400]
    VN24_04095
Enzymes [BR:pbj01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VN24_04095
DNA repair and recombination proteins [BR:pbj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     VN24_04095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AJY73941
UniProt: A0A0D5NFB1
LinkDB All DBs
Position
864921..865874
Genome map
AA seq 317 aa AA seqDB search
MKLTPIFPFEPISTSSFPIGEQWTAQIKWDGVRILSYYDGTESRLFNRKQNERTLQYPEL
TNPKLYCKADSFILDGEVIALENGKPSFHQVMKRDSLKHLSRIQEAKQRIPIAYMVFDIL
YCNGSWVIDEPLSKRQSLLEQVLMPGDVVQTVPSYRTIPELFQTAQQHQLEGIVIKDLTS
SYPLNGKDKRWQKRKIVQDLIAVVGGVTHRDGVVNALLLGLYDENRRLWYIGHAGTGKVK
VSDWNTLTEIARHLKRDAMPFVNRPDRSRDATWIEPQLTVKIQFLEWTKYRTLRQPSIQA
FVDTPPLECTWPAGNDV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttacgcccatattcccttttgagccgatatcgacgagcagcttccccatcggc
gaacaatggacggcgcaaatcaagtgggacggcgttcgcatactcagttattacgacgga
actgagtctcgtttatttaaccggaagcaaaacgagcggacgctgcagtatcccgagctg
acgaatccgaagctgtactgcaaggccgactccttcatcctcgacggcgaagtgatcgcg
ctcgagaacgggaagccgtcttttcatcaagtcatgaagcgcgacagcttgaaacatctc
tcccggatccaggaggcgaaacagaggattccgattgcctacatggtttttgatattctt
tattgcaatggatcgtgggttatcgatgagccgttaagcaagcggcagtcactgcttgaa
caagtgctgatgccgggcgatgtcgttcaaaccgttccaagctaccgtacgattccggag
ttattccaaacggcacagcagcaccaattggaaggcattgtcatcaaggatttgaccagc
agctacccgctgaacggaaaagataaacgatggcaaaagaggaaaatcgttcaggacctg
atcgccgtcgtcggcggagtcacgcaccgcgacggtgtcgtcaatgcccttctgctcgga
ctttacgacgaaaaccggcgattgtggtatatcggccatgcaggcacggggaaagtaaag
gtaagcgactggaatacactgacggaaatcgcccgccatctgaagcgggatgcaatgccg
tttgtcaatcggcccgaccggagccgggatgcgacatggatcgaacctcagctgacggtg
aaaattcaattcctggaatggacaaagtaccggacgctgcggcagccctcgattcaggct
ttcgtcgatacgccccctcttgaatgcacatggccggcggggaacgacgtttaa

DBGET integrated database retrieval system