KEGG   Paenibacillus beijingensis: VN24_07245Help
Entry
VN24_07245        CDS       T03802                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pbj  Paenibacillus beijingensis
Brite
Enzymes [BR:pbj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VN24_07245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: AJY74408
UniProt: A0A0D5NHL1
LinkDB All DBs
Position
1606110..1607315
Genome map
AA seq 401 aa AA seqDB search
MLFVYGSRMPLRLLEEIREWKTQEKEHMDVIQKAVPRLEPAYLALLRSWRTVFEKTEQRA
GAWLEAAVAAQARNAAPTFGDLRSGTDALLQAAALQSQTFALQLMQIVGGSAVLKADGAA
RSVVLHALRESTYYLGKMEAIEHARNQGVDPHTDPAAEKGGIPTAGLPGIGDGSGILAYE
HNLDLIGVEERESRKPVPIGGHTLPPLPYPYNALEPYIDEATMRIHHDKHHQSYVDGLNK
AEKELQQARQSGDFSLVRHWECELAFNGAGHYLHTLFWNVMSPQGGGRPVDELADEIDRS
FGSYEAFKKQFSEAAAKVQGGGWSILVWSPRSQRLEVLTAEKHQNLSQWDIVPVLPLDVW
EHAYYLKHQNKRADYIKDWWNVVNWPYVNERFHKAKTLVWD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgctttttgtttatggttcccggatgccgctgaggctgttggaagaaataagagagtgg
aaaacgcaggaaaaagaacatatggacgtcatccaaaaggccgttccccgcttggagccg
gcctatttggcgctgctgcgctcatggagaacggtgttcgagaaaacggagcagcgtgca
ggcgcttggctcgaagccgccgtcgctgcgcaggctaggaatgccgccccaactttcggc
gatctgcgaagcggaacggatgcgctgctgcaggcggcggccctccagtcgcagacgttc
gccttgcagctgatgcagatcgtgggcggcagcgccgttttaaaggcggatggggcagcg
cgctcggtcgtgctgcatgcgctgcgggaatcaacgtattacttgggcaagatggaagcg
atcgagcatgcccggaatcaaggcgtggatccgcacacggatccggcagcggaaaagggc
ggtatacctaccgccggattgcctggaatcggagacggcagcggcattttggcttatgag
cataatttggacctgataggcgtggaagagcgcgaatcccgcaaaccggtgccgatcggc
gggcatacgctccctccgctgccctacccttacaacgcgctggagccgtatatcgacgag
gccacgatgaggattcatcacgataagcaccatcaaagctatgtcgacggactgaataaa
gcggaaaaagaactgcagcaggcgcgacagagcggcgacttttcgcttgttcgccactgg
gagtgcgagcttgccttcaacggagcggggcattatttgcacacgttgttctggaacgtc
atgtcacctcaaggcggcggccggccggtagatgagcttgccgatgaaatcgaccgcagc
ttcggcagctacgaggcgttcaagaagcagttcagcgaagcggctgccaaggtacagggg
ggcggctggagcattctcgtctggagcccgcgcagtcaaaggctggaagtgctgaccgca
gagaagcatcaaaacctgtcccaatgggacatcgtcccggttcttccgcttgacgtatgg
gaacacgcttattacctcaagcaccaaaataaaagggccgactacatcaaagactggtgg
aacgtcgtcaactggccgtatgtaaatgaacggtttcacaaggcgaagacgctcgtatgg
gattga

DBGET integrated database retrieval system