KEGG   Paenibacillus beijingensis: VN24_08805Help
Entry
VN24_08805        CDS       T03802                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00564  Glycerophospholipid metabolism
pbj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VN24_08805
Enzymes [BR:pbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     VN24_08805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJY74659
UniProt: A0A0D5NH11
LinkDB All DBs
Position
complement(1977973..1979676)
Genome map
AA seq 567 aa AA seqDB search
MRSRFSAMEREKCIKELQEELLDVLVIGGGITGAGIALDAAARGMKVAAVEMQDFAAGTS
SRSTKLVHGGLRYLKQLQIGVVAEVGKERAIVYENGPHVTTPERMLLPIHAGGTFGTFST
SLGLKVYDYLAGVKRAERRVMLSAEQTLDKEPLLKRPGLKGGGYYVEYRTDDARLTIEVM
KAAVSRGAIAVNYAMVSELIYKNGKAAGARIVDRLSGKEYAVYARCVVNAAGPWVDAVRE
MDRSRQGKVLQLTKGVHLVFDARRFPLRQAVYFDTPDKRMVFAIPRDGKTYVGTTDTVYK
ENLEHPRMTKADRAYILDAVNGMFPGLNLAASDVESSWAGVRPLIYEEGKDPSEISRKDE
IWQSESGLLTIAGGKLTGYRKMAELVVDKVAERLQSQGYGTYRQSRTAALPISGGEVGGS
AGFAQYAAEKTAEGEKRGLPLELARAWVLRYGSNVNRLFELYRAFGQSPEAALLPAEVGV
PLQYAILEEMAVKPVDFFIRRTGAMFFDRAWVEQWIKPVTEAMAACLFWTKEQQERYLIE
LEDELRYAIVPADEVNRVSLPGKAISH
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagatcacggttctccgctatggagcgggaaaaatgcatcaaggaactgcaagaggaa
ctgctcgacgtgctcgtcatcggcgggggcattaccggcgcgggcatcgccctggacgcg
gcggcgcgggggatgaaggtagcggctgtcgagatgcaggattttgcggcgggcacatcg
agccgttcgacgaagctggtgcacggcggcctccgttatttgaagcagctgcaaatcggc
gtcgtggccgaagtcggcaaggagcgggcgatcgtctacgagaacggcccgcatgtgacg
acgccggagcggatgctgctgccgatccacgcgggcgggacgttcggcacattttccaca
tcgctcggattgaaggtatatgactatttggcgggagtgaagcgcgccgagcggcgcgtc
atgctgtcggcggagcagacgctggataaggaaccgctgctgaagcgtcccggactgaag
ggcggcggctattatgtggaataccggaccgacgatgcgcgtctcacgatcgaggtgatg
aaggcggcggtgagccggggggcaatagcggtcaattacgcgatggtttctgagttgatc
tataaaaacggaaaagcggccggcgcgcgcatcgtcgaccggctgagcggcaaggaatac
gcggtgtacgcgcgctgtgtcgtcaatgctgccggtccgtgggtcgacgcggtccgggag
atggaccgctcccgccagggcaaagtgctgcagctgacgaagggcgtgcatctggtgttc
gatgccaggcggtttccgctgcgccaggccgtctatttcgatacgcccgacaaaaggatg
gtatttgcgattccgcgcgacggcaaaacgtatgtcggcacgaccgacaccgtctacaag
gagaatctggagcatccccggatgacgaaggcggaccgcgcttatattctggatgcggtc
aacggcatgtttcccgggctgaaccttgccgcatccgatgtggaatcaagctgggcgggc
gtacgtccgctcatctatgaggaaggcaaggacccgtcggaaatatcgcgcaaggacgaa
atttggcagtccgaatccgggctgctcacgatcgcgggcgggaagctgaccggctaccgt
aaaatggcggagctggtagtggacaaagtggccgagaggctgcaaagtcaagggtacggg
acgtaccggcaaagccggacggcagcgctgccgatttccggcggcgaagtaggcggctcc
gccggtttcgcgcagtatgcggccgagaagacggcggaaggcgagaagcgcggcctgccc
cttgagcttgcgcgcgcgtgggtgttgaggtacggttccaacgtgaaccggctgttcgag
ctgtaccgagcgttcggccagtcgcccgaagcggctctgctgccggctgaagtgggtgtg
ccgctccagtatgcgattttggaagaaatggcggtgaagccggtcgatttcttcatccgg
cgcacaggggcgatgtttttcgaccgggcgtgggtggagcaatggataaagccggttacc
gaggcgatggcggcgtgcttgttctggacgaaagaacagcaggagcgctatttgatcgag
ctggaagacgagctgcggtacgcgattgtgcctgccgatgaggttaaccgcgtcagcttg
ccggggaaggcaatatcccattaa

DBGET integrated database retrieval system