KEGG   Paenibacillus beijingensis: VN24_12930Help
Entry
VN24_12930        CDS       T03802                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00620  Pyruvate metabolism
pbj00680  Methane metabolism
pbj01100  Metabolic pathways
pbj01120  Microbial metabolism in diverse environments
pbj01200  Carbon metabolism
Module
pbj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VN24_12930
  09102 Energy metabolism
   00680 Methane metabolism
    VN24_12930
Enzymes [BR:pbj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VN24_12930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AJY75311
UniProt: A0A0D5NJ67
LinkDB All DBs
Position
2821538..2824342
Genome map
AA seq 934 aa AA seqDB search
MSEQAVTTQTTNRPHSNNLLRRDVRFLGNILGEVLVHQGGRELLDVVEKIRETSKALRAE
FIPELFEEFKSTITSLNPEIRHQVIRAFAIYFQLVNIAEQNHRVRRKRDYERSVGETVQP
GSIEDAVQTLKERGIAVGEVNSMLEGISLELVMTAHPTEATRRVVQDIHQRIATNLMELD
NPMLSYREREKQREKLLNDVLILWQTDELRNRKPTVIDEVRNGLFYFDETLFETLPNVYE
ELERCLSKYYPGEQWHVPAYLRFGSWIGGDRDGNPSVTAKVTWETLKLHRQLAIRKYEEI
LKDWMGLLSFSTNIVSVPDELLESISADQSEVELKGIDIWRNSKEPYKVKLCYMLEKLAN
TRDGSLKGTRKRYNSPAELKEDLLLIDRSLRAHYADYTADSVVQKLIRQVELFGFHMAAL
DIRQHSKEHENAMAEVLAKNNIESDFSALSEDEKIALLERLLADPGKLTSDDAEYSESTR
ECLDVFRTVYEAQQEFGTGCITSYLISMARGASDMLMVMVFAKEFGLFRQEEDGSVICSL
QSVPLFETIDDLHAAPGIMKRLFDLPLYRKAVEARGEMHEIMLGYSDSNKDGGVVTANWE
LKLALNEITAAAAEYGVKLKFFHGRGGALGRGGMPLNRSILAQPPHTIGAGIKITEQGEV
LSSRYSMQGIAYRSLEQATWALITAARLVKYPEQETDQESEWNEIARSMSETAQTKYQDL
IFRDPDFMTFFKESTPLSEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAW
YAAGTAFEQFVQNDPAKLDKLREMYKGFPFFRQLVDNLQMALAKADLNIAQQYAGMISDA
EVRDRIFNQVKEEHALTLKFILDITGQQDILDNVPVIQESIRLRNPYVDPLSYMQVELLT
ELRKLREQEGDDTELLREVLLTINGIAAGLRNTG
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacaggctgtaacgacccagacaacaaataggccgcattcgaacaacttactg
cgtcgggatgtacggtttctgggaaacattttaggagaagttcttgttcatcagggaggg
cgcgagctgctcgatgtggtggagaaaatccgcgaaacgagcaaagcgctccgtgcggaa
ttcattcccgagcttttcgaagaattcaaaagcacgattacgtcgcttaatcccgaaatt
cgccatcaagtgattcgcgcttttgcgatctattttcagctggtcaatattgccgaacaa
aatcaccgtgttcgccgcaagcgcgattatgagcgttcggttggcgaaacggtgcagccg
ggctcgatcgaagacgcggtccaaacgcttaaagagcgcgggattgccgtcggagaggtc
aactcgatgctggagggcatttcgctcgagcttgtcatgaccgctcatccaacggaagcg
acacgccgcgtcgttcaagatattcaccagcggatcgcaaccaatctgatggaactggac
aatccgatgctgagctaccgtgagcgggagaagcagcgggagaagctgctgaacgatgtg
ctcattttgtggcagaccgacgagctgcgcaatcgcaagcctaccgttatcgacgaagtg
cgcaacggcttattttacttcgatgagacgctgtttgaaacgctgccgaatgtttatgag
gagctggagcgttgtcttagcaaatactacccgggagaacaatggcacgttccggcttac
ctgcgcttcggttcatggatcggcggcgaccgcgacggcaacccttccgtaacggccaaa
gtgacttgggagacgctaaaactgcaccggcagctggccattcgcaagtatgaagagatt
ttgaaggattggatggggctgctgagcttcagcacgaacatcgtcagcgtgccggacgag
ctgctggaatccatcagcgccgatcagagcgaagtggagcttaaaggcatcgacatttgg
cgcaactccaaagagccttataaagtcaagctttgctacatgctggagaagctcgccaac
acgcgcgacgggtcgcttaaaggaacgcgcaagcgttacaacagtcctgccgagctgaag
gaggatctgctgctgatcgaccgcagcctgcgggcccattatgccgattacacggcggat
tcggttgtgcagaagctgatccgtcaagtcgagctgttcggcttccatatggccgcgctg
gacattcgtcagcacagcaaagagcatgagaacgccatggcggaagttttggcgaaaaat
aacattgagagcgacttctcggccctttcggaagatgagaaaatcgcactgttggaacgt
ttgctcgccgatcccggcaagctcacctcggacgatgccgaatactccgaatcgacacgc
gaatgtctggatgtgtttcgtacggtttacgaggctcagcaggaattcgggaccggctgt
attacgagttatctgatcagtatggcacgcggcgccagcgatatgctcatggtgatggtg
tttgccaaagagttcggcctgtttcgtcaggaagaggacggttccgtcatctgttcgctg
cagtcggtgccgctttttgaaacgattgacgatctgcacgcggcgccgggcattatgaaa
cggctctttgacctccccctgtaccgcaaagcggtggaagccagaggggaaatgcacgaa
attatgcttggctattcggacagcaacaaagacggcggcgttgttactgccaactgggag
ctgaagctggcgcttaacgaaataacggctgccgcagccgagtacggcgtgaagctgaaa
tttttccatgggcggggcggagcgctcggccgcggcggaatgccgctgaaccgcagcatt
ttggcgcagccgccgcacacgatcggcgccggtatcaaaattaccgagcagggcgaggtg
ctctcttcgcggtattcgatgcagggcatcgcctaccgcagcctggagcaggcgacatgg
gcgcttattacggcagcccgcctggtcaaatatccggagcaggagacggatcaggaatcg
gaatggaacgaaattgcccgcagcatgtccgagacggctcagacgaagtatcaggacctt
attttccgcgatccggatttcatgacgttcttcaaggaatcgacgccgctgtcggaagta
ggcgagctgaacatcggctcccggccgtccaagcgcaagaacagcgaccgctttgaagat
ttgcgggcgatcccatgggtatttgcctggacgcaaagccgctatcttctgccggcatgg
tatgcggccggaaccgcatttgagcagtttgtgcagaatgatcctgccaagctggataag
ctgcgggaaatgtataaaggcttcccgttcttccgtcagctggtggacaatttgcagatg
gcactcgcaaaagcggatttgaacattgcccagcagtatgccggaatgatcagcgacgcc
gaggtgcgcgaccgcatctttaatcaggtgaaggaagagcacgcgctcacgttaaagttc
attctcgacattacggggcagcaggatattctggataacgtaccggttattcaggagtcg
atccgcctgcgcaatccttatgtggacccgctcagctacatgcaggtggagctgctgacg
gagctgcgcaagctgcgggagcaggaaggcgacgatacggagctgctgcgtgaagtgctt
ttgacgattaacggcattgcagcaggccttcgcaatacgggctga

DBGET integrated database retrieval system