KEGG   Paenibacillus beijingensis: VN24_16580Help
Entry
VN24_16580        CDS       T03802                                 

Definition
(GenBank) glycoside hydrolase
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VN24_16580
Enzymes [BR:pbj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     VN24_16580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AJY75874
UniProt: A0A0D5NKJ6
LinkDB All DBs
Position
3664817..3666295
Genome map
AA seq 492 aa AA seqDB search
MSTMIKHNYRGKYHFSPKEKWMNDPNGMVYFKGEYHLFYQHHPYGMTWGPMHWGHAVSKD
LIVWEELDIALAPDENGMIFSGSAVVDWNNTTGFFENEPGLVAIFTHHLVQEGGDPVQTQ
SLAYSKDSGRTWTKYEGNPVLKHDTFVDFRDPKVFWHEQTGRWVMVIACGQSVCIYHSGD
LKSWTFGSEFGADIGFHGGVWECPDLFALAVDGDSSRQKWVMLVSIGDHPAYKEGSRTQY
FTGEFDGVTFMPDEDSYTVRWLDYGRDNYAGVSWSDVPAADGRRLFIGWMSNWKYANLTP
TEGFRGAMTVPREIGLGSLADGSVILVQKPVHELERARVPVLELENVSREEAEEALSALQ
LESYEVTAVVPAGSTFAFKVRKGGRIETVVGVEASRGEVYVDRTKSGLHQFHEHFSGVHA
AKLQSPGKTLDLRIFMDLSSVEVFANDGQAVITDLIYPNADSTEISLVSDEERFKLYSLS
VYTLVPSAKGSN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgtctacgatgatcaaacacaattacagagggaaatatcatttttcgccaaaagagaag
tggatgaacgacccgaacgggatggtgtattttaaaggggagtatcatcttttctatcag
catcatccgtatggaatgacctggggcccgatgcattggggccatgcggtgagtaaagac
cttatcgtatgggaagaactcgatattgcgctcgcgccggatgagaatggcatgatcttt
tcaggaagcgctgtcgtggattggaacaatacaacgggatttttcgaaaatgaaccgggc
cttgtcgcgatttttacgcatcatcttgtgcaggagggcggcgacccggttcaaacccag
agcctggcgtacagcaaggacagcggaagaacctggacgaagtatgaagggaatccggta
ctgaagcacgacacttttgtcgactttcgcgatcccaaggtgttctggcacgagcagacc
gggcggtgggtcatggtgatcgcttgcgggcaatcggtctgcatctatcattcgggcgat
ttgaaatcgtggacattcggaagcgagttcggggccgatatcggtttccatggcggtgtt
tgggagtgcccggatttgttcgccctggcggtcgatggggattcatcgcgtcaaaagtgg
gtgatgcttgtcagcatcggcgatcacccggcctataaggaaggctcgagaacgcagtat
tttactggtgaatttgacggagtgacgtttatgcccgatgaggattcgtacacggtgcgc
tggctggattacggcagggataactacgccggcgtaagctggtccgacgttccggctgcg
gatggcagacgtctctttatcggttggatgagcaactggaaatatgccaaccttacccca
acggaagggtttcgcggtgcaatgaccgtaccgagagaaatcgggctcgggtcgcttgcg
gacggcagcgtgatcttggtacagaagcccgtgcatgaactggagcgtgctcgcgttccg
gtattggagcttgagaatgtttccagggaagaagcggaggaagcgctgtccgccttgcaa
ttggagagctacgaggtaacagccgtcgtcccggccggttcaacttttgcattcaaggta
agaaagggcggccggatcgagaccgtggtcggagttgaggcaagccggggcgaagtttat
gtcgaccggacgaaatccggattgcatcaatttcatgagcatttcagcggcgttcatgca
gccaagctgcaatctccgggaaagacgctcgatctaagaatctttatggacctctcttcc
gttgaagtattcgcgaatgacgggcaggcggtaattaccgacctgatctatccgaatgcc
gattccacagaaatctccctggtttccgatgaggaacggtttaagctttattcattgtcg
gtctatacgttggtaccgtctgccaagggttcgaactaa

DBGET integrated database retrieval system