KEGG   Paenibacillus beijingensis: VN24_17915Help
Entry
VN24_17915        CDS       T03802                                 

Definition
(GenBank) hypothetical protein
Organism
pbj  Paenibacillus beijingensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Post_transc_reg
Motif
Other DBs
NCBI-ProteinID: AJY76094
UniProt: A0A0D5NL65
LinkDB All DBs
Position
3968900..3969139
Genome map
AA seq 79 aa AA seqDB search
MRNDELNGEIFTLCESKAEEFRLIGYEQVTAQDIWDCVSDKYAKHGEPPLHQLVNDILSL
KTPKFMNFLTMSAYKGTRF
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgaggaatgacgagctgaacggcgaaatatttacgctttgcgaaagcaaggcggaggaa
tttcggctcatcggatacgaacaagtgacggcgcaggatatatgggattgcgtcagcgac
aaatatgccaaacacggcgaaccgcctttgcatcaactcgtaaatgacatcctgtcgctt
aaaacgccgaagtttatgaattttttaacgatgagcgcatacaagggaacccgtttttaa

DBGET integrated database retrieval system