KEGG   Paenibacillus beijingensis: VN24_17940Help
Entry
VN24_17940        CDS       T03802                                 

Definition
(GenBank) (p)ppGpp synthetase
  KO
K00951  GTP pyrophosphokinase [EC:2.7.6.5]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00230  Purine metabolism
pbj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VN24_17940
Enzymes [BR:pbj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     VN24_17940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_4 RelA_SpoT TGS ACT_4 HD ACT ThiS DUF1444 ACT_6 SIS Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: AJY76096
UniProt: A0A0D5NLE6
LinkDB All DBs
Position
3975818..3977998
Genome map
AA seq 726 aa AA seqDB search
MGIEQLLEKASTYMKDQDLQRVRVAYEFAEQAHHGQVRKSGEPYILHPIAVADILVNMQM
DVTSIIAALLHDVVEDTTVDLAEVRARFGETCAMLVDGLTKLEKIRFRSKEEQQNENYRK
MFVAMAQDIRVILIKLADRLHNMRTLKFQSEEAQRRIAYETLEIFCPIAHRLGISAIKWE
MEDIALRYLNPQQYYRIANLMKKKRVEREAYISTVVGRISEKLEEMGIDGDISGRPKHIY
SIYRKMSMRNKQFSEIYDLMAIRIIVDNIKDCYATLGIIHTLWKPMPGRFKDYIAMPKAN
MYQSLHTTVIGPNGEPTEVQIRTWEMHRTSEYGIAAHWAYKEGMPTPGGNFEDKMTWFRE
ILELQHEAEDASEFMESLKMDFFSDLVFVFTPKGEVIELPAGSVSLDFAYRIHTEVGNRT
IGAKVNGRIVPLDQKLKTGDIVEILTSKHSYGPSQDWIKIAQSSHARSKIKQWFKREKRE
ENVAKGREMLERELKRLGLETSVWMTEDKLQEAATKFTFTDIEDMMSAIGFGGITAAQVC
SKMTEKMRREAEEANLIELTNEPKEMKTPGPKKKPATGGVSVKGIDNLLVRFARCCYPVP
GDEIVGYITRGRGVSIHRKDCPNLPIEMEGEEADRLIEVEWEDSADSNYSVDIEVTGHDH
RGLLNEVLQAVSESKTNISAVTGRTGKNKMVIIHMTILIRNVDHLQSVVEKIKRLKDIYS
VQRIMQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgggcatagagcagctactcgaaaaagcgtcgacatatatgaaagatcaggatctgcag
cgggtgcgcgtcgcatacgaatttgccgagcaggctcatcacgggcaagtgcgcaaatcc
ggcgagccgtatattttacatccgatcgcagtcgcggacattctggtcaatatgcaaatg
gacgtcacgtcgattatcgccgcgctgctgcacgacgttgtggaagacacgaccgtggat
ctggccgaggtgagggcgcggttcggggagacgtgcgccatgctggtcgacggcttaacc
aagctggagaaaatccgctttcgctcgaaggaagagcagcaaaacgagaattaccgtaaa
atgttcgtcgccatggcgcaggatatccgcgtcattctgatcaagctggcggaccgtctt
cataatatgcgtacgctcaaatttcagtcggaggaagcgcagcggcggatcgcttacgaa
acgctcgaaattttttgcccgattgcgcaccggctcggcatttcggcgattaaatgggag
atggaagatatcgcgctgcgctatctgaatccccaacagtattatcgcattgccaatttg
atgaaaaaaaagcgggtcgagcgcgaagcatacatttccacagttgtcggccgcattagc
gagaagttggaagaaatgggcatcgacggcgatatttccggccgtccgaagcatatttac
agtatttaccgcaaaatgtcgatgcgcaacaagcagttcagcgaaatctacgatttgatg
gcaatccggattatcgtggacaacattaaggactgctacgccacgctcggcattattcat
acattgtggaagccgatgccgggacggttcaaagactatatcgccatgccgaaggcgaat
atgtaccagtcgctgcatacgaccgtcatcggtccgaacggcgagccgacggaagtgcaa
atccgcacgtgggaaatgcaccgcacaagcgaatacgggatcgccgcccactgggcgtac
aaagaaggcatgccgactccgggcggaaatttcgaagataagatgacctggttccgcgaa
atcttggagcttcagcatgaagccgaggacgcctcggagtttatggaatcgctcaaaatg
gactttttctccgacctcgtgttcgtttttacgcccaaaggggaagtgatcgagctgcct
gccggctccgtgtcgctggacttcgcgtaccggattcatacggaagtcggcaaccggacg
atcggcgcgaaggtgaacggacggattgtgccgctggaccaaaagctgaagaccggggac
atcgtggagattttgacgtcgaagcattcctacggcccaagccaggactggatcaaaatc
gcccaatcgtcgcatgcgcgctccaaaatcaaacaatggttcaagcgcgagaagcgcgag
gaaaatgttgcaaagggacgcgaaatgctcgaacgcgagctgaaacggctcggtctggag
acatcggtctggatgaccgaagacaagcttcaagaagcggcgaccaagttcaccttcacc
gatatcgaagatatgatgtccgcgatcggattcggaggcattacggctgcccaggtttgc
agcaaaatgacggagaagatgcgcagggaagcggaagaagcgaacctgatcgagctgacg
aacgaaccgaaggaaatgaaaacgccgggtccgaagaaaaagccggctacgggcggcgtt
tccgtgaaggggatcgacaacctgctcgtccggttcgcccgctgctgttatcctgttccg
ggcgacgaaatcgtcggctacattacgcgcggacgcggcgtatccattcaccggaaagat
tgtcccaaccttccgatcgagatggagggcgaggaagcggaccgcctgatcgaagtggaa
tgggaagattcggccgattccaactacagcgtcgacatcgaagtgacgggccacgaccac
cgtggattgctgaacgaagtgctgcaggcggtatcggagagcaaaacgaacatttccgcc
gttaccggccgcaccggcaaaaacaaaatggtcatcattcatatgaccatactcattcgc
aatgtcgaccacctgcagtcggtcgtcgagaagatcaaacgtttgaaagacatttactcg
gtgcagcgcattatgcagtga

DBGET integrated database retrieval system