KEGG   Paenibacillus beijingensis: VN24_24320Help
Entry
VN24_24320        CDS       T03802                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbj  Paenibacillus beijingensis
Pathway
pbj00020  Citrate cycle (TCA cycle)
pbj00310  Lysine degradation
pbj00380  Tryptophan metabolism
pbj01100  Metabolic pathways
pbj01110  Biosynthesis of secondary metabolites
pbj01120  Microbial metabolism in diverse environments
pbj01130  Biosynthesis of antibiotics
pbj01200  Carbon metabolism
Module
pbj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VN24_24320
  09105 Amino acid metabolism
   00310 Lysine degradation
    VN24_24320
   00380 Tryptophan metabolism
    VN24_24320
Enzymes [BR:pbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     VN24_24320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AJY77102
UniProt: A0A0D5NQ26
LinkDB All DBs
Position
complement(5385301..5386590)
Genome map
AA seq 429 aa AA seqDB search
MAEIKVPDLGESITEATITKWLKKEGDAVSQGDLLLELETDKVNLEISAEQDGVLSSIAK
GDGETVSVGETIGTIGAGGAAKAPAAAPAPAAQPAAPASAAPAPGAVAAQPKAEPKPVSK
APAESAAVPTASPSARKLAREKGIDLSLVSSRDGSGRIYSSDVASYSAQPVISQAAPALY
PAPAAVPSPKTAEQPGKPVERTKMSRRRQTIAKRLVEAQQTAAMLTTFNEVDMTAILDIR
KRRKQSFQEKNDIGLGFMSFFTKAVVGALKKFPLLNAEIDGDELVVKKFYDIGIAVAAKE
GLVVPVVRDADRLGFAEIEKSIADLAAKARSNTLALGDLQGGTFTITNGGVFGSLLSTPI
LNAPQVGILGMHKIQLRPVAIDAERSENRPMMYIALSYDHRIVDGAEAVRFLVTVKELLE
DPETLLLEG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagattaaagtccccgatttgggagaatccattacggaagcaacgatcaccaaa
tggctgaaaaaggaaggggacgccgttagtcaaggcgatctgcttctcgagctggaaacc
gacaaggtaaacctggaaatcagcgccgagcaagacggcgtcctcagcagcatcgccaaa
ggagacggcgaaaccgtctccgtcggagagacgatcggcacgatcggcgcaggaggtgcg
gcaaaagctcctgctgccgctccggctcctgcagcgcagccggcggcgccggctagcgcg
gcgcctgctccgggtgcagtcgccgcacagccgaaagccgagccgaagccggtatcgaag
gcgcctgccgaaagcgccgcagtgcccacggcttccccttcggcgcgcaagcttgcgcgc
gagaaagggatcgatctgagcctggtgagcagccgcgacggaagcggacgcatttacagc
agcgatgtcgcctcctactcggcgcagccggtcatatcccaagcggctccggcattgtat
cccgctccggccgccgtgccttcgccgaaaacggccgagcagcccggcaaaccagtggaa
cggacgaaaatgtcccgccgccgccaaacgatcgcgaagcgtctcgtcgaagcacagcaa
acggcggcgatgctgacgacgttcaacgaagtcgatatgaccgccatcctcgacatccgc
aaacgccggaaacaatcgtttcaggagaagaacgatatcggactcggctttatgtccttc
tttacgaaagcggtcgtaggcgcgctgaagaaatttccgctgctgaacgcggagattgac
ggggacgagctggtcgtcaaaaagttttatgacatcggcatcgccgttgcggcgaaggaa
gggcttgtcgttcccgtcgtgcgcgacgccgaccgtctcggattcgccgagatcgaaaaa
agcatcgccgatctggcggccaaagcccgctccaacacgctggcgctcggcgacttgcaa
ggaggaacgttcacgatcacgaacggcggcgtattcggatcgctgctgtcgacaccgata
ttgaacgctccgcaggtcggcattctcggcatgcacaaaatccagctgcgtccggtcgcc
atcgacgcggagaggtccgagaaccgtccgatgatgtacattgcgctttcgtacgatcac
cggatcgtggacggggcggaagcggtccgtttccttgtgacggtaaaggaactgctcgaa
gatccggagacactgctgcttgagggctga

DBGET integrated database retrieval system