KEGG   Paenibacillus baekrokdamisoli: Back11_54170
Entry
Back11_54170      CDS       T06671                                 

Gene name
gtfA_2
Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
pbk  Paenibacillus baekrokdamisoli
Brite
KEGG Orthology (KO) [BR:pbk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Back11_54170 (gtfA_2)
Enzymes [BR:pbk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     Back11_54170 (gtfA_2)
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: BBH24072
UniProt: A0A3G9J0K2
LinkDB
Position
6125221..6126690
AA seq 489 aa
MAVKNQVQLITYPDSLGGNLKALNQVLIEHFSDIFKGGVHILPPFPSSGDRGFAPLTYLE
IDPSFGTWEDIRAIGENFDVLIDLMVNHISRQSDYFQDFLERGRTSEFADLFLTLDKLWE
DGEPVPEDIAKMFLRRPFPYSAFTIKETGEEEKVWTTFGKTDPSEQIDFDIKSRKFKQLI
TEFFMNFKKQNVKIVRLDAVGYVIKKLGTSCFFVEPEIYEFLNWIMDLADSLEIDLLPEV
HAHYTTQYKLAEHGCWIYDFILPYRVLDTLINKSSDDLCQYLRTRPEKQFTMLDCHDGIP
VKPDMDDLIDTTEARKLVDVCLERGSNLSLILSDKHKSDDGFDVHQIRCSYYSVLNCDDD
AYLAARAIQFFAPGIPQVYYVGLLAGENDLEGVRKSTEGREINRHNFSIEEINQALDKEV
VQRLLELIRFRNEYGAFNGKFSVLDSPKNEIRLAWEKDDQSCSLFINLQTNKSVIEYRDE
DGKVVEYVI
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggctgttaaaaatcaggtgcaacttatcacttaccccgattccttaggtggaaatttg
aaggctcttaaccaagtccttatcgagcatttttcagatatatttaaaggtggagttcat
attctgcctccatttccatcttcgggagataggggatttgccccattgacttatctggaa
atcgatccgagttttggtacttgggaggatataagagccattggagaaaacttcgatgta
ttgatcgatttaatggttaaccacatttcaaggcaatctgattattttcaggactttctt
gaaagaggacgaacatccgaatttgctgatttattcctaactttggacaagctttgggag
gatggcgagccagtaccagaagatattgcaaaaatgtttttgcgtagaccattcccgtat
tctgcttttactattaaggaaacaggtgaagaagaaaaggtatggacgacgttcggtaag
acggatccttctgaacaaattgactttgatattaaatctcggaagtttaaacaactcatt
acggaattttttatgaactttaagaagcaaaacgtaaagatcgtaaggttggatgcggta
ggatatgtgattaagaagcttggaacaagctgttttttcgttgaaccggaaatatacgaa
ttccttaattggatcatggaccttgcagattcattagagattgatttgcttcctgaagtt
cacgcacactatacgacccaatacaagctggcggagcacggctgttggatttatgatttc
atacttccatacagagtacttgatactttgatcaataagtccagcgatgatctctgtcag
tatctcagaactcgccctgaaaagcagtttactatgctggactgtcatgacggcattcct
gttaagccggatatggatgacctaatagatacgacagaagcaagaaagttagtggatgtt
tgtctagaaagaggctcgaaccttagtctcattttatccgataagcataagtctgatgat
ggatttgatgttcatcaaatcaggtgctcgtattactccgttctgaattgcgacgacgac
gcgtacttagcggccagagccattcaattttttgcaccagggataccccaggtatattat
gttggactactcgcaggagaaaatgatcttgaaggcgttaggaaaagcacagaaggtcga
gaaatcaaccgccacaactttagcatagaggaaattaaccaagctcttgataaagaagta
gttcagagacttttagagctgataaggtttagaaatgagtatggtgcttttaatgggaag
ttttcagttctagattcacctaagaatgaaattcgccttgcatgggaaaaagatgatcag
tcttgtagtctgtttatcaatcttcaaacaaacaagtccgtcattgagtatagggatgag
gacggtaaagtagtcgaatatgttatataa

DBGET integrated database retrieval system