KEGG   Paracoccidioides lutzii Pb01: PAAG_01015Help
Entry
PAAG_01015        CDS       T02230                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00010  Glycolysis / Gluconeogenesis
pbl00051  Fructose and mannose metabolism
pbl00052  Galactose metabolism
pbl00500  Starch and sucrose metabolism
pbl00520  Amino sugar and nucleotide sugar metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01200  Carbon metabolism
Module
pbl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pbl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_01015
   00051 Fructose and mannose metabolism
    PAAG_01015
   00052 Galactose metabolism
    PAAG_01015
   00500 Starch and sucrose metabolism
    PAAG_01015
   00520 Amino sugar and nucleotide sugar metabolism
    PAAG_01015
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PAAG_01015
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pbl04131]
    PAAG_01015
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PAAG_01015
Membrane trafficking [BR:pbl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PAAG_01015
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 9100675
NCBI-ProteinID: XP_015700995
UniProt: C1GR70
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MPPPPPRRRSSRKGSMAEMPTELLDQLKTLEELFTVDQAKLKKIVDHFIKELEKGLSVDG
GNIPMNVTWVLGFPTGYERGTYLSLDMGGTNLRVCEIHLTEEKGEFDITQSKYRIPDELK
NGSSEDLWEYIADCVQQFIEHYHEGDISIPDFPMGFTFSYPATQDYIDHGVLQRWTKGFD
IDGVEGHDVVPMLKAALAKKNLPIKITALINDTTGTLIASAYTDPEMRIGCIFGTGVNAA
YMENAGSIPKIAHYNLPPDTPVAINCEYGAFDNDHIVLPLTQYDIIIDRDSPRPGQQAFE
KMTAGLYLGEIYRLVLLDLIDNKNNLIFPNQDVSGLRKPYSLDSSFLSYIEEDPFENLSK
TRDLFQRKLGIYASSSELEFCRRLAELIGTRAARLSVCGVAAICKKKNISHCHVGADGSV
FNKYPHFKARGAKALREILDWPDNEPDRIVMSGAEDGSGVGAALIAALTLERVKKGNLVG
IQNKETIKKFC
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgcctcctcctcgccgaaggtcctcccgtaagggatcaatggctgaaatgcca
acggagttgctggaccagctcaaaacattggaggaactctttacggtcgatcaggcaaaa
ctgaagaagatcgttgatcattttatcaaggagttagagaagggcctaagtgtcgatgga
ggaaacattcctatgaacgtaacatgggtcttggggttccccactggctatgagcgaggc
acatacctctccctcgatatgggcggtaccaatctacgagtttgtgaaattcacctcacc
gaagagaagggcgagttcgacatcacacaatccaagtaccgaatacccgatgagctgaag
aacggaagctcagaagacctctgggagtatattgccgactgcgtgcagcagttcatcgaa
cattaccatgaaggcgatatatccatcccggatttcccaatgggcttcacgttctcctac
cccgctacgcaggattatattgatcatggagtcctgcagaggtggaccaagggctttgat
atcgacggagtggagggccatgatgttgttccaatgttaaaagcagcgttggctaagaag
aacctccccattaagatcaccgctctaatcaatgacacaaccggcaccctcatcgcctcc
gcttataccgatcccgagatgagaatcggttgtatattcggcactggcgtcaatgccgcc
tacatggaaaacgccggttccatccccaaaattgcccactacaacttacccccggacacc
cccgtcgccatcaactgcgaatacggcgccttcgacaacgatcacatcgtcctcccccta
acccaatacgacatcataatcgaccgcgactcaccccgaccaggccaacaggccttcgaa
aagatgaccgcaggcctctacctgggcgaaatctaccgcctcgtcctcctcgacctcatc
gataacaagaacaatctcatcttccccaaccaagacgtctccggactgcgcaaaccctac
tccctcgactcctccttcctctcctacatcgaagaagaccccttcgaaaacctctcgaag
actcgcgacctcttccagcgcaagctgggcatctacgcctcctcctctgagctggaattc
tgccggcgcctggcggaattaatcggcactcgtgccgcgcgcctctccgtctgcggcgtt
gcggccatctgcaagaagaaaaatatctcacattgtcatgttggtgcggacgggtcggtg
tttaacaagtatccgcatttcaaagctaggggtgccaaggcactgagggagattctggac
tggccggataatgagccggatcggattgtgatgagtggtgcggaggatggatccggtgtt
ggtgcggcgttgattgcggcgttgacgcttgagagggttaagaagggcaatttagtgggg
attcagaataaggagacgataaagaagttttgttga

DBGET integrated database retrieval system