KEGG   Paracoccidioides lutzii Pb01: PAAG_02688Help
Entry
PAAG_02688        CDS       T02230                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00500  Starch and sucrose metabolism
pbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAAG_02688
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PAAG_02688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 9098406
NCBI-ProteinID: XP_015701799
UniProt: C1GVZ3
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MLAFFLCTVWVLSLFRVVQAQSQDPLGLKATGSLDAWIAKESPYALQALLANIGADGTKA
KGAAAGIVIASPSKSDPDYFFTWTRDAALVFKGLVDAFISGNTGLQPKLHEFISSQARLQ
TVSNPSGGLSSGGPGEPKFHVDMSPFNGDWGRPQRDGPALRATAMISYARWLVANGYSDT
AKSIVWPVVQNDLSYVSQFWSFSGYDLWEEINSMSFFTTAVQHRALVEGARLARQLGLTC
RNCESQAPQILCSLQNYWTGSYINSNTGGGRSGKDTNSILASIHTFDPEAACDDTTFQPC
SAKSLANHKVVTDAFRSLYALNSGIPAGSAVSVGRYPEDLYYGGNPWYLSTFAAAEQLYD
AIYQWQRIGSISITNVSLPFFRDVYGSAMIGTYSSSSSAFKSIIEAVRNYADGFLAIAQK
YTPESGALAEQFSRDTGTPLSAGDLTWSYASFLTAIARRSSIVPDPWGETDANGIPKTCQ
ATSATGPYITATNTNWPSNLTPIKRTATPTSTSTASTTSSFPCVTPGSVNVTFNQIATTL
FGQMILLVGSIPELGSWAPGSAIALSADQYSDANHLWYKTITLSAGQKFEYKYIRQETDG
NIVWESGSNRLYTVPRGCNIYTARREDNWRSQWAFYTEETQTWYARKD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccttttttctttgcactgtttgggtgctctcgttgttccgggtggtgcaggct
caatcccaagatccacttgggttaaaagccactggctcattagatgcgtggattgcaaag
gaaagcccgtatgccctacaggcgctcctagccaatattggagcagatggtacaaaggca
aaaggtgcagctgctggtattgtcattgcaagccctagcaaaagcgaccctgattacttt
tttacttggactcgagatgctgccttagtattcaaaggccttgtggatgcctttatttcc
gggaacactggtcttcaaccgaaacttcatgaatttatcagctcacaagcccgccttcag
acagtgtctaatccttcgggagggctctcatcgggtggccctggtgaacctaaatttcat
gtcgacatgtcaccattcaatggtgactggggtcgaccccaaagagatggacctgccttg
agggcaactgctatgatttcttatgcgagatggctcgttgcaaatgggtactctgatact
gcgaaatcgatagtttggcctgtggtccagaacgacctttcttatgtgagccagttctgg
agcttttctggctatgatctctgggaggagataaacagcatgtccttttttacaacagcg
gtgcagcatcgcgctcttgttgaaggcgcaagacttgcacgtcagttaggactcacctgc
cggaactgcgaatcccaagctcctcagattctctgttctctgcagaattactggacgggt
tcctatatcaattccaataccggcggtggtaggtctggtaaagacactaactctattctc
gcaagcattcacacatttgaccctgaggctgcttgtgatgacacgactttccaaccttgt
tccgctaaatcactggcaaaccataaggtggtaacagatgctttccgttctctatatgct
ttgaattctggtatcccagcaggttcagccgtttcggtcggtcgatatcctgaagatctc
tactatggcgggaacccctggtatctgagtacctttgccgcagcggagcagttgtatgat
gctatttaccagtggcaaaggattggttcgatttcgattaccaatgtgtcacttcctttc
tttcgagatgtttatggttctgccatgattggaacttattcgtcttccagttcagctttc
aagtcgataatagaggctgtaagaaattatgcagatggattcctagctattgcgcaaaaa
tacaccccagagtccggcgctctggccgagcaattctcccgggacactgggacccctctg
tcagcaggtgatttgacatggtcatacgcctcgttccttacggctattgcccgacgtagt
tcaattgtcccagatccttggggagagaccgacgctaacggcatcccgaaaacttgtcaa
gctacgtcagcgaccgggccttacatcacagcaactaatactaattggccgtcgaacctc
acacctatcaagagaacggcgacgcccacatctacttccacagcttccaccacatcatca
tttccatgcgtcacccctggctctgtcaacgtgacattcaatcaaatcgctacaacttta
tttggccagatgattctcctcgtcggctccattccagagctcgggtcctgggcacctgga
tctgcaattgccctctctgcggaccagtattccgatgccaaccatttgtggtataaaact
attacattgagtgcaggccaaaagttcgaatataaatatattcgtcaggaaacggacggt
aatatcgtgtgggagagtggctccaaccgcctctataccgtaccgcgtggatgtaatatt
tatacggcaaggagggaagacaattggcgttcgcaatgggcattttatacagaagagacg
caaacatggtatgctaggaaagattga

DBGET integrated database retrieval system