KEGG   Paracoccidioides lutzii Pb01: PAAG_02747Help
Entry
PAAG_02747        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 9098465
NCBI-ProteinID: XP_015701812
UniProt: C1GW52
LinkDB All DBs
Position
Unknown
AA seq 656 aa AA seqDB search
MENPEAQLQHSLRSLAATEDIRSLPTDPSLTSRISAHFEAAAAAAAVTGGPQPFAVLQAT
TTGTTAAGTHLQHSPLTHAERLIDNSVNPPSLPPHQQQLSPAHHQHQFHTPNNNGFLDHR
SNGQVDMLQHLQTPLPAHLLNQFHSTSPNIEAANHSDQSPSPASAHNRGEGHFKNMKLIP
NPPDLKRWRERLFNVDDDPIVMSEEEFQTYFPHVDNVYSHRSTQKYKRKLFVSHYWDCRL
KGRPPGTPKSRDPSKKKRKRTARERDLCDVKIKITEYFPGALAVPPNLLGLDAMSSLEQN
MQNAAAAVATGTDFLDPVVAGQNELARVANSNNPQPQAEPHYQFGVLTLRKTLPQGHPGY
TGEKYYTIQRVNGNGGNGRADGIGGPHRHTLEESDRVKKNSVQRHMLKVEKERRKTMAHQ
KTYHKKASGLAATTVKKHAKEADLKLFGSCFCPFVQRVWIALEVKGIPYQYIEIDPYKKP
DSLLEVNPRGLVPAIRHGNWECYESTVLLEYLDDLDTGNLLLPSRDPQLRAHCRLWADHI
NRHIIPTFYRLLQEQDLQKQIQHSEELKEEISKLVNASHMQGPFFLGPAISFVDIQFAPW
MLRLSRVLKPYRGWPDPEKGSRWAAWVDAIESDERVRATTSADDLYLDSYERYAGK
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccccgaggcacagctgcaacacagcttgcgcagtctcgccgccaccgaagac
atccggtcccttccaacagatcccagtttaacctcaagaatcagcgcccacttcgaagca
gcagcagcagcagcagccgtcacgggcggaccccagccctttgcagtgctgcaggcgacg
acaacaggaactacagcagcgggaactcatttgcaacattccccccttacgcatgctgag
cggctcatcgacaactctgttaaccctccatcattaccgccgcaccaacaacagttatcg
cccgcacatcaccagcatcaattccacacgccaaataataatggttttctcgatcacaga
agtaatggccaggtcgatatgctgcagcatctgcagacgcctctcccggcgcatctcctg
aaccaattccacagcacctcgcctaatatcgaagctgccaatcactcagaccaatcgccc
tcgcctgcttccgcccataacagaggagaaggccactttaaaaatatgaaattgatacca
aatcctcccgatctaaagagatggagggagcgattatttaacgtggatgatgatccaatt
gtgatgagcgaagaagagttccaaacttacttcccccatgttgacaacgtctattcccac
cgttccacccagaaatacaaacgcaagctcttcgtctcgcactactgggactgtcgcctc
aagggccgccccccaggaaccccaaagtcccgtgatccaagcaagaagaagcgcaaacgc
acagcccgcgagcgcgatttatgcgacgtcaaaatcaagattacagagtatttccccgga
gccctggctgtgcctccgaacctgctgggtctggatgccatgtcctccttggagcaaaat
atgcaaaatgctgccgctgccgttgctactggtaccgatttcctcgaccccgttgttgct
ggccagaatgaactggcgcgtgttgccaatagtaataatccacagccacaagcagagcct
cactatcagtttggcgtcctgacgttgcggaagacgctacctcagggccaccctggctat
acgggtgagaagtactatacaatccagagggttaatgggaatgggggaaatgggagggca
gatggcattggcgggccccataggcatacactggaggaaagcgacagggttaagaagaat
agcgtgcagcgtcatatgcttaaggtggagaaggagaggaggaaaactatggcccaccag
aaaacctatcacaaaaaggcctctggccttgccgccacaactgtcaaaaagcacgctaag
gaagcagatttgaagctctttggaagttgtttctgtccgttcgtccagcgtgtttggata
gcgttggaggtcaaggggatcccataccagtatatcgagattgatccgtacaagaagccc
gattcgttgctggaggtgaatccacgtggtttggtgcctgccatccggcatgggaactgg
gaatgctatgagagtacagttttgctggaatatctcgacgaccttgatactggtaatctt
ctactcccgtcgagagatcctcaactacgcgctcattgccgtttatgggcagatcacata
aaccgccacataatccctaccttctaccgcctcctgcaagagcaagacctgcaaaagcaa
atccagcactcagaagagctgaaggaagagattagcaagcttgttaatgcctcgcacatg
caagggccgttcttcctcggcccggcaatctcctttgtagatatccaatttgcaccctgg
atgctacggctcagccgcgtgctgaaaccgtatcggggctggccggatcctgagaaaggg
agtcgctgggctgcatgggtggatgctatcgagtctgatgaacgtgtcagggccacgacg
agcgcggatgacctgtatttggatagttatgagaggtatgctggtaagtaa

DBGET integrated database retrieval system