KEGG   Paracoccidioides lutzii Pb01: PAAG_04238Help
Entry
PAAG_04238        CDS       T02230                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00020  Citrate cycle (TCA cycle)
pbl00190  Oxidative phosphorylation
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01200  Carbon metabolism
Module
pbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAAG_04238
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAAG_04238
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAAG_04238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 Pyr_redox_2 GIDA Thi4 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 9097106
NCBI-ProteinID: XP_015699444
UniProt: C1H0E4
LinkDB All DBs
Position
Unknown
AA seq 677 aa AA seqDB search
MFSQASMSMRRILAPTRHFPLAGKVDMHLSSTSYFPKHNDYTRKPSAGLDNQRLWKRSFT
STSGLYALQGVGQAKAVGLNHIQIIDHRYDALVVGAGGAGLMAAVGLAECGLETACISKL
FPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIHYMCKEAPKTVLEL
EGYGMPFSRTAEGKIYQRPIGGQSLKYGSGGQAYRTACAADRTGHAMLHALYGQSLKHDC
KFFIEFFALDLMMVDGRCVGVTALDMETGTLHRLFSRNTIIATGGYGRAYFSCTSAHTST
GDGCAMASRAGLPLQDMEFVQFHPSGIYSAGVLITEGARGEGGYLLNSEGERFMERYAPT
AKDLASRDVVARSMNMEIREGRGVGPDKDHIYLQLSHLPKELILERLPGIAETASIFAGI
DITRQPIPVLPTVHYCMGGIPTNYKGQVLNVDLATGKETPVPGLYAAGEAACVSVHGANR
LGANSLLDIAVFGRASAAHIAENNEKGMLHSSVPRDIGMPSFEDMERLRTSDGRKLTAEL
RLDMQKAMQSDVAVFRAEDSLTSGVSKVQQVEHSFRHDVCVKDKSLIWNSDLIETLEMRN
LLTCAAQTAKSALDRKESRGSHAREDFPDRDDVQFLKHSLSWQTEETEPVKVGYRDVIFA
TLDETDCPSVAPKKRTY
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcaagcgtccatgtccatgaggaggatcctcgcgccaacccggcacttcccc
ttggccggcaaagtcgacatgcacctatcctctacctcctatttcccgaaacataatgac
tacacaaggaagccgtcggcaggccttgacaaccagcggttatggaagaggagttttacc
tccacgtcgggactatatgcgctacaaggtgttgggcaggcaaaggctgttgggcttaat
catatccagataattgatcaccgatatgacgcccttgttgttggtgcaggaggagcaggt
cttatggcggccgttggcctggcggaatgtgggttggaaaccgcctgtatatcaaaattg
tttccaacgagatcacatactgtagctgctcaaggtggtatcaatgctgcccttggcaat
atgacagaggacgactggagatggcatatgtatgatacggttaaaggctcagactggcta
ggggatcaggatgcaattcattacatgtgcaaggaagccccgaaaaccgttttagagttg
gaaggatatggtatgccattttcccggactgcagagggcaagatttatcagcgtcctatt
ggagggcaatccctgaaatacggttctggcggccaagcctatcgaactgcgtgtgcggct
gatcgtaccggacatgcgatgctgcatgccttgtatggtcaatctttaaagcatgattgc
aaatttttcattgagttcttcgccttagacctgatgatggtcgatggccggtgcgtcggt
gtaactgcactagacatggaaactggtacgcttcaccgtctgttcagcaggaacacaatc
atagcgactggtggatacggccgcgcctatttctcctgcacgtccgcacataccagcacg
ggtgacgggtgcgccatggcatctagagctggccttcctctccaagacatggaatttgtt
cagtttcaccctagcggaatatacagcgcaggtgtgctgattaccgaaggtgcacgtgga
gaaggaggctacctacttaactccgaaggagagagattcatggaacgatacgcgccaacc
gccaaggaccttgctagccgagacgtggtggcccgatccatgaacatggagatcagagag
ggaaggggtgtaggtcctgataaggatcatatttacttgcaactatcccatcttcccaag
gaattgatcctagaacggcttcctggaattgcagaaacggcctccatcttcgcgggcatt
gacattacccgacaaccgattcccgtacttcccaccgtccattattgtatgggcggtatc
cccaccaactacaagggccaagtcctaaacgttgatcttgcaaccggaaaagagacgcca
gtccccggactttatgcagctggagaggctgcatgcgtaagcgtacatggcgcaaataga
ctaggagccaactccctgctcgacattgccgtgtttggtcgtgcaagtgccgctcatatt
gcagaaaacaacgaaaagggaatgctgcacagctccgtaccaagggatatcggtatgcca
tcattcgaagacatggaacgactccgcacatcagacggaagaaaattaactgccgagctg
cgtttggacatgcaaaaagccatgcagtctgacgtcgcagtgtttcgagcagaagactcg
ctcacgtctggtgtctctaaagtacagcaggttgagcactcattcagacatgatgtttgc
gtaaaggacaaatcactaatctggaattcggatttgattgagaccttggagatgaggaat
cttcttacgtgcgctgctcagacggctaaaagcgctttggacaggaaagagagcagaggt
agccatgctcgtgaagacttccctgatcgagatgatgtgcagttcttaaaacacagcctt
tcgtggcagacggaggagacggagccggttaaggtgggttatcgggatgttatttttgcg
acgttggatgagacagattgtccaagcgtggcaccaaagaaaaggacatattaa

DBGET integrated database retrieval system